DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY8 and Fpr-rs6

DIOPT Version :9

Sequence 1:XP_006724506.2 Gene:P2RY8 / 286530 HGNCID:15524 Length:548 Species:Homo sapiens
Sequence 2:XP_001073753.1 Gene:Fpr-rs6 / 690230 RGDID:1582880 Length:343 Species:Rattus norvegicus


Alignment Length:338 Identity:81/338 - (23%)
Similarity:140/338 - (41%) Gaps:58/338 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   211 IAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDLMLASVLPFQIYYHCNR 275
            |.:.|.||.|:...:.:.||...::|...||.....::.: :||::.|....:.|||||......
  Rat    25 IWIFLVVVLSITFVLGVLGNGLVIYVAGFRMASTVTTICY-LNLALADFSYMASLPFQIISIVIN 88

Human   276 HHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYAVAACAGTWLLL 340
            ..|.||..||..|.:....|::.||..:|.|:::|.:.||:|:.::.:|....|.....|.|:|:
  Rat    89 GEWPFGWFLCKFVHMIININLFLSIFLITFIAMDRCICVLHPVWAQNYRTVNLARKVIVGAWILV 153

Human   341 LTALSPLARTDLTYPVHALGIITCFD----------VLKWTMLP------SVAMWAVFLFTIFIL 389
            |..:.|          |.:.:.|..|          |..|...|      |:.:..:.:...|::
  Rat   154 LLLIFP----------HLIFLTTVRDERGKVHCICNVESWAATPEEQLKVSMTVRIISVTISFLI 208

Human   390 LFLIPFVITVACYTATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRL 454
            .|.||.:..|.||.....|:.|    .|.....|.:.:...|..:|..|:.|...:.|...:.  
  Rat   209 GFSIPMIFIVICYGLMAAKIGR----RGFVNPSRPLRVLTAVAFSFFVCWFPFQLIFLLGNIG-- 267

Human   455 FYGKSYYHVYKLTL-----------CLSCLNNCLDPFVYYFASREFQLRLREYLGC---RRVPRD 505
                     ||.|:           .|:..|:||:|.:|.|..::|:.:|...|..   |.:..|
  Rat   268 ---------YKETMNSIHTWVNPASTLASFNSCLNPILYVFLGQQFRKKLIHSLSASLERALRED 323

Human   506 TL--DTRRESLFS 516
            ::  ..:..:|||
  Rat   324 SVLNSDKVRNLFS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY8XP_006724506.2 7tm_4 222..>321 CDD:304433 28/98 (29%)
7tm_1 229..482 CDD:278431 66/279 (24%)
Fpr-rs6XP_001073753.1 7tm_1 43..297 CDD:278431 66/279 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.