DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY8 and Hcar1

DIOPT Version :9

Sequence 1:XP_006724506.2 Gene:P2RY8 / 286530 HGNCID:15524 Length:548 Species:Homo sapiens
Sequence 2:NP_001138806.1 Gene:Hcar1 / 689936 RGDID:1586364 Length:351 Species:Rattus norvegicus


Alignment Length:355 Identity:91/355 - (25%)
Similarity:149/355 - (41%) Gaps:57/355 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   187 PSRMQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFM 251
            ||.|        ||.:..::....|...:|.:..|...:...||..:|...|..|.....|.|::
  Rat     6 PSAM--------DNGSCCLIEGEPITQVMPPLLILAFLLGALGNGLALCGFCFHMKTWKSSTIYL 62

Human   252 INLSVTDLMLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLY 316
            .||:|.|.:|...||.:..|:..|.||:.|.:.|.:|......|...||:.:|.::|:|:..|::
  Rat    63 FNLAVADFLLMICLPLRTDYYLRRRHWILGDIPCRLVLFMLAMNRAGSIVFLTVVAVDRYFKVVH 127

Human   317 PLSSKRWRRRRYAVAACAGTWLLLLTALSPLARTDLTYPVH--ALGIITCFDVLKWTMLPSVAMW 379
            |.........|.|.|.....|.|::     |....|....|  ..|:::..:..   ::.|...|
  Rat   128 PHHMVNAISNRTAAAIVCVLWTLVI-----LGTVYLLMESHLCVRGMVSSCESF---IMESANGW 184

Human   380 AVFLFTIFILLFLIPFVITVACYTATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNF 444
            ...:|.   |.|.:|..|.:.|....:..|.:.::...:.:.|||.....||...|:||:.|:  
  Rat   185 HDIMFQ---LEFFLPLTIILFCSFKVVWSLRQRQQLTRQARMRRATRFIMVVASVFITCYLPS-- 244

Human   445 VLLAHIVSRLFY---------GKSYYHVYKLTLCLSCLNNCLDPFVYYFASREF-----QLRLRE 495
                 :::||::         ..|.:....:||.|:.||:.|||.||||:|..|     :|::| 
  Rat   245 -----VLARLYFLWTVPSSACDPSVHIALHVTLSLTYLNSMLDPLVYYFSSPSFPKFYAKLKIR- 303

Human   496 YLGCRRVPRDTLDTRRESLFSARTTSVRSE 525
                      :|..||.....||    |||
  Rat   304 ----------SLKPRRPGRSQAR----RSE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY8XP_006724506.2 7tm_4 222..>321 CDD:304433 29/98 (30%)
7tm_1 229..482 CDD:278431 67/263 (25%)
Hcar1NP_001138806.1 7tm_1 40..286 CDD:278431 67/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.