DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY8 and Gpr87

DIOPT Version :9

Sequence 1:XP_006724506.2 Gene:P2RY8 / 286530 HGNCID:15524 Length:548 Species:Homo sapiens
Sequence 2:NP_001101147.1 Gene:Gpr87 / 310443 RGDID:1307852 Length:354 Species:Rattus norvegicus


Alignment Length:348 Identity:96/348 - (27%)
Similarity:151/348 - (43%) Gaps:39/348 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   194 NSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTD 258
            |||...:.......|....:.|||:|.::...||..|..::|:.. .:..::..:.::.|:.|.|
  Rat    20 NSTIEGHGKNSTHHNEFDTIILPVLYLVIFVASILLNGLAVWIFF-HIRNKTSFIFYLKNIVVAD 83

Human   259 LMLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRW 323
            |::....||:|........|.|..:||...:|.||||||:||:.:..|||:|:|.|:.|....|.
  Rat    84 LIMTLTFPFRIVRDAGFGPWYFEFILCRYTSVLFYANMYTSIVFLGLISVDRYLKVVKPFGDSRM 148

Human   324 RRRRYAVAACAGTWLLLLTALSPLARTDLT--YP----VHALGIITCFDVLKWTMLPSVAMWAVF 382
            ....:........|:::  |:..|....||  .|    :|        |.:| ...|..|.|.:.
  Rat   149 YSITFTKVLSICVWVIM--AVLSLPNIILTNGQPTKENIH--------DCMK-LKSPLGAKWDMA 202

Human   383 LFTIFILLFLIPFVITVACYTAT---ILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNF 444
            :..:...||:...||.:.||.|.   |.|..|...:....:|:....: .||:..|.|||.|.:.
  Rat   203 VTYVDSCLFVAVLVILIGCYIAISRYIHKSSRQFISQSSRKRKHNQSI-RVVVAVFFTCFLPYHL 266

Human   445 VLLAHIVSRL------FYGKSYYHVYKLTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVP 503
            ..:....|.|      ...|..::..::||.||..|.||||.:|:|..:.|..||        ..
  Rat   267 CRIPFTFSHLDRLLDDSAHKILHYCKEMTLFLSACNVCLDPIIYFFMCKSFSRRL--------FK 323

Human   504 RDTLDTRRE---SLFSARTTSVR 523
            :..:.||.|   ||.|.|.:.||
  Rat   324 KSNIRTRSESIRSLQSVRRSEVR 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY8XP_006724506.2 7tm_4 222..>321 CDD:304433 31/98 (32%)
7tm_1 229..482 CDD:278431 72/267 (27%)
Gpr87NP_001101147.1 7tm_4 53..>164 CDD:304433 32/111 (29%)
7tm_1 56..310 CDD:278431 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.