DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY8 and Cmklr2

DIOPT Version :9

Sequence 1:XP_006724506.2 Gene:P2RY8 / 286530 HGNCID:15524 Length:548 Species:Homo sapiens
Sequence 2:NP_037093.1 Gene:Cmklr2 / 25457 RGDID:2728 Length:353 Species:Rattus norvegicus


Alignment Length:327 Identity:85/327 - (25%)
Similarity:148/327 - (45%) Gaps:44/327 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   217 VVYSLVAAVSIPGNLFSLWVLCRRMG---PRSPSVIFMINLSVTDLMLASVLPFQIYYHCNRHHW 278
            ::|:|...:.||||...:|.    ||   .::.:.::.:||::.|.:....||..|.|.....||
  Rat    43 LLYALAFVLGIPGNAIVIWF----MGFKWKKTVTTLWFLNLAIADFIFVLFLPLYISYVALSFHW 103

Human   279 VFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYAVAACAGTWLLLLTA 343
            .||..||.:.:.....||:||:..:|.||::|::.:::|..|...|..:.::......|||....
  Rat   104 PFGRWLCKLNSFIAQLNMFSSVFFLTVISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLL 168

Human   344 LSPLARTDLTYPVHALGIITCFDVLK----WTMLPSVAMWAVFLFTIFILLFLIPFVITVACYTA 404
            ..|......|..|:  ..|.|::..:    ..|...|..|..|||.     :|:|.:...:||..
  Rat   169 GGPTLYFRDTVEVN--NRIICYNNFQEYELTLMRHHVLTWVKFLFG-----YLLPLLTMSSCYLC 226

Human   405 TILKLLRTEEAHGREQR----RRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYK 465
            .|.|.        ::|.    .:.:.:...|::||:.|:.|  |.|.:.....:.:..|:.:|.:
  Rat   227 LIFKT--------KKQNILISSKHLWMILSVVIAFMVCWTP--FHLFSIWELSIHHNSSFQNVLQ 281

Human   466 ----LTLCLSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTL------DTRRESLFSARTT 520
                |:..|:.||:||:|.:|...|::||.|.|..:.  .|.:.:|      .|..|.|.||.|.
  Rat   282 GGIPLSTGLAFLNSCLNPILYVIISKKFQARFRASVA--EVLKRSLWEASCSGTVSEQLRSAETK 344

Human   521 SV 522
            |:
  Rat   345 SL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY8XP_006724506.2 7tm_4 222..>321 CDD:304433 29/101 (29%)
7tm_1 229..482 CDD:278431 66/267 (25%)
Cmklr2NP_037093.1 7tm_1 55..302 CDD:278431 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.