DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR37 and CCHa2-R

DIOPT Version :9

Sequence 1:NP_005293.1 Gene:GPR37 / 2861 HGNCID:4494 Length:613 Species:Homo sapiens
Sequence 2:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster


Alignment Length:404 Identity:96/404 - (23%)
Similarity:166/404 - (41%) Gaps:57/404 - (14%)


- Green bases have known domain annotations that are detailed below.


Human   191 GSHHKPLSKTANGL-AGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPL 254
            |::...|..|..|| ...||..:.:...|.|..|.:                        |:.|:
  Fly    23 GANDSGLLATGQGLEQEQEGLALDMGHNASADGGIV------------------------PYVPV 63

Human   255 TQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLLANLAFWDFLIIFFCLPLVI 319
            .... ..|.|..|..:||..|::||..::.|...:..||:|.|:.:.:||..|.|:|..|:|:..
  Fly    64 LDRP-ETYIVTVLYTLIFIVGVLGNGTLVIIFFRHRSMRNIPNTYILSLALADLLVILVCVPVAT 127

Human   320 FHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRFRAATNVQMYYEMIENCSSTTAKLA 384
            .....:.|..|...|:|..:.:..|:||:.|||.||..:|:.|..|.   ...::....|.....
  Fly   128 IVYTQESWPFERNMCRISEFFKDISIGVSVFTLTALSGERYCAIVNP---LRKLQTKPLTVFTAV 189

Human   385 VIWVGALLLALPEVVLRQL-SKEDLGFSGRAPAERCIIKISPDLPDTIYVLALTYDSARLWWYFG 448
            :||:.|:||.:|.|:...: |......:|....|.|    || ..|..|...:....|.:     
  Fly   190 MIWILAILLGMPSVLFSDIKSYPVFTATGNMTIEVC----SP-FRDPEYAKFMVAGKALV----- 244

Human   449 CYFCLPTLFTITCSLVTARKIRKAEKACTRGNKRQIQLESQMNC------TVVALTILYGFCIIP 507
             |:.||........::.|:::..:.:... |.::.:|..:|...      .|||..:::..|..|
  Fly   245 -YYLLPLSIIGALYIMMAKRLHMSARNMP-GEQQSMQSRTQARARLHVARMVVAFVVVFFICFFP 307

Human   508 ENICNIVTAYMATGVSQQTMD----LLNIISQFLLFFKSCVTPVLLFCLCKPFSRAFMECCCCCC 568
            .::..:...:..|  :::..|    :|.|:.....|..|||.||.|:|:...|.:.|....||.|
  Fly   308 YHVFELWYHFYPT--AEEDFDEFWNVLRIVGFCTSFLNSCVNPVALYCVSGVFRQHFNRYLCCIC 370

Human   569 ---EECIQKSSTVT 579
               :..:::.||.|
  Fly   371 VKRQPHLRQHSTAT 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR37NP_005293.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..138
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..172
7tmA_GPR37 262..560 CDD:320255 77/308 (25%)
TM helix 1 263..289 CDD:320255 8/25 (32%)
TM helix 2 296..322 CDD:320255 8/25 (32%)
TM helix 3 334..364 CDD:320255 12/29 (41%)
TM helix 4 377..397 CDD:320255 6/19 (32%)
TM helix 5 439..464 CDD:320255 4/24 (17%)
TM helix 6 485..515 CDD:320255 7/35 (20%)
TM helix 7 528..553 CDD:320255 11/28 (39%)
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 77/308 (25%)
TM helix 1 71..97 CDD:320593 8/25 (32%)
TM helix 2 104..130 CDD:320593 8/25 (32%)
TM helix 3 142..172 CDD:320593 12/29 (41%)
TM helix 4 182..202 CDD:320593 6/19 (32%)
TM helix 5 234..259 CDD:320593 4/30 (13%)
TM helix 6 285..315 CDD:320593 5/29 (17%)
TM helix 7 330..355 CDD:320593 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.