DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ANK1 and SPBP16F5.05c

DIOPT Version :9

Sequence 1:	XP_011542792.1	Gene:	ANK1 / 286	HGNCID:	492	Length:	1969	Species:	Homo sapiens
Sequence 2:	NP_595779.1	Gene:	SPBP16F5.05c / 2541266	PomBaseID:	SPBP16F5.05c	Length:	146	Species:	Schizosaccharomyces pombe

Alignment Length:	137	Identity:	41/137 - (29%)
Similarity:	70/137 - (51%)	Gaps:	13/137 - (9%)

- Green bases have known domain annotations that are detailed below.

Human    84 DLLLRCRISQSTGLLRVLYN-----QNRKKNGLNGLHLASKEGH---VKMVVELLHKEIILETTT 140
            ||:..||.:....|..::..     ..|.:||.:|||:||..||   |:.::..|:||:| ....
pombe     5 DLIYACRAADEELLDEIIEKCPQELSRRDENGNSGLHMASANGHIAVVQKIIPYLNKEVI-NAQN 68

Human   141 KKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLE----NGAN 201
            :.||||:|.|||.|..|:.:.|:..|.:.:.::....:|:|.|...|..:|:...|:    .|:.
pombe    69 ESGNTAMHWAALNGHAEICKLLLEAGGDPHIKNIYEKSPIYEADIRNQQKVMDLFLDFEIAKGSE 133

Human   202 QNVATED 208
            :|...|:
pombe   134 ENTGDEE 140

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ANK1	XP_011542792.1	ANK	47..163	CDD:238125	30/86 (35%)
		ANK repeat	47..75	CDD:293786
		ANK	108..229	CDD:238125	35/108 (32%)
		ANK repeat	109..140	CDD:293786	14/33 (42%)
		Ank_2	114..204	CDD:289560	30/96 (31%)
		ANK repeat	143..173	CDD:293786	12/29 (41%)
		ANK	170..324	CDD:238125	9/43 (21%)
		ANK repeat	175..206	CDD:293786	8/34 (24%)
		ANK repeat	208..232	CDD:293786	0/1 (0%)
		ANK repeat	241..268	CDD:293786
		Ank_2	242..333	CDD:289560
		ANK	265..390	CDD:238125
		ANK repeat	271..301	CDD:293786
		ANK repeat	303..334	CDD:293786
		Ank_2	308..397	CDD:289560
		ANK repeat	336..367	CDD:293786
		ANK repeat	369..400	CDD:293786
		Ank	402..432	CDD:278452
		ANK repeat	405..433	CDD:293786
		ANKYR	406..619	CDD:223738
		ANK	430..555	CDD:238125
		ANK repeat	435..466	CDD:293786
		ANK repeat	468..499	CDD:293786
		ANK repeat	501..532	CDD:293786
		ANK	529..654	CDD:238125
		ANK repeat	534..563	CDD:293786
		ANK repeat	568..598	CDD:293786
		ANK repeat	600..631	CDD:293786
		Ank_2	605..696	CDD:289560
		ANK repeat	633..661	CDD:293786
		ANK repeat	666..697	CDD:293786
		ANK	666..695	CDD:197603
		ANK	694..819	CDD:238125
		ANK repeat	699..730	CDD:293786
		Ank_2	704..795	CDD:289560
		ANK repeat	732..763	CDD:293786
		ANK repeat	765..796	CDD:293786
		Ank_5	785..839	CDD:290568
		ANK repeat	798..826	CDD:293786
		ZU5	984..1088	CDD:128514
		Death_ank1	1474..1557	CDD:260067
SPBP16F5.05c	NP_595779.1	ANK	6..124	CDD:238125	36/118 (31%)
		Ank_2	6..101	CDD:289560	31/95 (33%)
		ANK repeat	6..33	CDD:293786	4/26 (15%)
		ANK repeat	35..68	CDD:293786	14/33 (42%)
		ANK repeat	70..101	CDD:293786	12/30 (40%)
		Ank_2	76..>136	CDD:289560	15/59 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2336
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030