DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANK1 and res1

DIOPT Version :9

Sequence 1:XP_011542792.1 Gene:ANK1 / 286 HGNCID:492 Length:1969 Species:Homo sapiens
Sequence 2:NP_595496.1 Gene:res1 / 2541153 PomBaseID:SPBC725.16 Length:637 Species:Schizosaccharomyces pombe


Alignment Length:465 Identity:104/465 - (22%)
Similarity:159/465 - (34%) Gaps:121/465 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   275 LHIAAHYENLNVAQLLLNRGASV-----NFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKT 334
            :.:|..|...::.|.|:....|.     .||||:...|.. |.||.:.:               .
pombe    85 VELAHEYNVFDLIQPLIEYSGSAFMPMSTFTPQSNRKPTE-AYRRNSPV---------------K 133

Human   335 KDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYD-AEIDD 398
            |....|.|           .:|..:.:.....:.:.:|.||.|          |.||.| ....|
pombe   134 KSFSRPSH-----------SLLYPYTSSNNMTSTSRMSGIHDA----------LSLQSDFTRSPD 177

Human   399 ITLDHLT-PLH--VAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGA 460
            :..|..| .||  .|:....:..|:.|||....||:.....|.         :.|..:..:..| 
pombe   178 MPSDSFTGSLHDIKASPFSSNNYAQSLLDYFLLPNTTQPPDFV---------YDRPSDWDVNAG- 232

Human   461 SIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPL------HMAARAGHTEVAK 519
                :.|.|.|.||.|:.||:|.::..|||.||:....|...:|.|      .|.......||..
pombe   233 ----IDEDGHTALHWAAAMGNLEMMHALLQAGANVVAVNYLQQTSLMRCVMFTMNYDLQTFEVVS 293

Human   520 YLLQNKAKVNAKAKDDQTPLHCAARIGHTN--------MVKLLLENNANP----------NLATT 566
            .|||:...:|...  .||..|..|.:..:.        .:.:||:|....          ||...
pombe   294 ELLQSAICMNDSF--GQTVFHHIALLASSKSKMEAARYYMDILLQNLTATQSVDVAAQIINLQDD 356

Human   567 AGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERD-AHPNAA 630
            .|.|.|.|.||.|..:....||...||.:....:|..|            .:.|..:| :.|   
pombe   357 HGDTALLICARNGAKKCARLLLSFYASSSIPNNQGQYP------------TDFLSSKDMSFP--- 406

Human   631 GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW----------------NGYTPLHIAAKQNQ 679
             :|..:||:..:..|.:|.:|  .|:....|..:.                |.:|.|...:|.::
pombe   407 -ENDDSPLNSKIEDNLIDNLK--YPQSLDDHLSSKKPISYFSNKLTHQTLPNVFTQLSELSKCHE 468

Human   680 VEVARSLLQY 689
            ..:|...|.|
pombe   469 ASLAEKQLTY 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANK1XP_011542792.1 ANK 47..163 CDD:238125
ANK repeat 47..75 CDD:293786
ANK 108..229 CDD:238125
ANK repeat 109..140 CDD:293786
Ank_2 114..204 CDD:289560
ANK repeat 143..173 CDD:293786
ANK 170..324 CDD:238125 13/53 (25%)
ANK repeat 175..206 CDD:293786
ANK repeat 208..232 CDD:293786
ANK repeat 241..268 CDD:293786
Ank_2 242..333 CDD:289560 13/62 (21%)
ANK 265..390 CDD:238125 22/119 (18%)
ANK repeat 271..301 CDD:293786 6/30 (20%)
ANK repeat 303..334 CDD:293786 4/30 (13%)
Ank_2 308..397 CDD:289560 15/89 (17%)
ANK repeat 336..367 CDD:293786 3/30 (10%)
ANK repeat 369..400 CDD:293786 9/31 (29%)
Ank 402..432 CDD:278452 11/32 (34%)
ANK repeat 405..433 CDD:293786 10/30 (33%)
ANKYR 406..619 CDD:223738 58/238 (24%)
ANK 430..555 CDD:238125 32/138 (23%)
ANK repeat 435..466 CDD:293786 3/30 (10%)
ANK repeat 468..499 CDD:293786 13/30 (43%)
ANK repeat 501..532 CDD:293786 9/36 (25%)
ANK 529..654 CDD:238125 32/143 (22%)
ANK repeat 534..563 CDD:293786 7/46 (15%)
ANK repeat 568..598 CDD:293786 11/29 (38%)
ANK repeat 600..631 CDD:293786 5/31 (16%)
Ank_2 605..696 CDD:289560 18/102 (18%)
ANK repeat 633..661 CDD:293786 7/27 (26%)
ANK repeat 666..697 CDD:293786 7/24 (29%)
ANK 666..695 CDD:197603 7/24 (29%)
ANK 694..819 CDD:238125
ANK repeat 699..730 CDD:293786
Ank_2 704..795 CDD:289560
ANK repeat 732..763 CDD:293786
ANK repeat 765..796 CDD:293786
Ank_5 785..839 CDD:290568
ANK repeat 798..826 CDD:293786
ZU5 984..1088 CDD:128514
Death_ank1 1474..1557 CDD:260067
res1NP_595496.1 KilA-N 26..102 CDD:282266 4/16 (25%)
ANKYR 125..280 CDD:223738 47/204 (23%)
ANK 233..378 CDD:238125 40/146 (27%)
ANK repeat 236..304 CDD:293786 22/67 (33%)
Ank_2 241..329 CDD:289560 25/89 (28%)
ANK repeat 306..355 CDD:293786 9/50 (18%)
Ank_2 <351..>394 CDD:289560 14/42 (33%)
ANK repeat 357..388 CDD:293786 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.