DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR35 and TkR86C

DIOPT Version :9

Sequence 1:NP_001182310.1 Gene:GPR35 / 2859 HGNCID:4492 Length:340 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:313 Identity:75/313 - (23%)
Similarity:136/313 - (43%) Gaps:58/313 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    43 DLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADL---CLLCTL 104
            :|.|..  |..:....|:::.:.:..|.:.||:........|.|..::.||::|||   .|.|..
  Fly    77 ELPWEQ--KTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVF 139

Human   105 PFVLHSLRDTSDTPL----CQLSQGIYLTNRYMSISLVTAIAV--DRYVAVRHPLRARGLRSPRQ 163
            .|:...   .||.|.    |.::.  ::.|..:|.|:.|.:|:  |||:|:.|||:.|  .|.|:
  Fly   140 NFIFML---NSDWPFGSIYCTINN--FVANVTVSTSVFTLVAISFDRYIAIVHPLKRR--TSRRK 197

Human   164 AAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNS-------MAFP-------------- 207
            ...:..::|.|.. .|.|..||      :....|:|.:|.       |.:|              
  Fly   198 VRIILVLIWALSC-VLSAPCLL------YSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAYN 255

Human   208 ----LLGFYLPLAVVVFC-SL--KVV---TALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFL 262
                :|.:.:|:.|::.| ||  :|:   .::.:.....:...::.||..||..|.:.:|.:|:|
  Fly   256 LIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWL 320

Human   263 PLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQ 315
            |.|  |....|...|..|..:.::........|:.:|..::.:.||:|.|.|:
  Fly   321 PYH--LFFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKRFR 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR35NP_001182310.1 7tm_1 74..307 CDD:278431 64/272 (24%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 71/296 (24%)
7tm_1 100..363 CDD:278431 66/278 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.