DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR34 and AstC-R1

DIOPT Version :9

Sequence 1:NP_001091048.1 Gene:GPR34 / 2857 HGNCID:4490 Length:381 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:390 Identity:101/390 - (25%)
Similarity:165/390 - (42%) Gaps:67/390 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     8 MTTTS---VSSWPYSSHRMRFIT--NH-------SDQPPQNFSAT--PNVTTCPMDEKLLSTVLT 58
            ||..|   .::| |:::...:.|  ||       :.||.::...|  |....|.......:.:.|
  Fly    17 MTADSEANATNW-YNTNESLYTTELNHRWISGSSTIQPEESLYGTDLPTYQHCIATRNSFADLFT 80

Human    59 -TSYSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKWTL 122
             ..|..:.|:||.||.:.:||.|...:.:....||:||:|:||...:..:|| ::|.:....|..
  Fly    81 VVLYGFVCIIGLFGNTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPF-LLYTMRICSWRF 144

Human   123 GVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWMLALGGFL 187
            |..:||.......:..:.|.|.|..:|.||||.:...|...:..|...:..|..|.|..:....|
  Fly   145 GEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLML 209

Human   188 TMIILTL---KKGGHNSTMCFHYRD---KHNAKGEAIFNFILVVMFWLIF---LLIILSYIKIGK 243
            .:|:...   ::.|.|.:....:.|   ||:..     .|||.. |:|.|   |..|||:.    
  Fly   210 PVILYASTVEQEDGINYSCNIMWPDAYKKHSGT-----TFILYT-FFLGFATPLCFILSFY---- 264

Human   244 NLLRISKRRSKFPNSGKYATTARNS--------FIVLIIFTICFVPYHAFRFIYISS---QLNVS 297
             .|.|.|.||..|..|..:...|.:        ..|:.::.:|::|:...:...|.|   |.::|
  Fly   265 -YLVIRKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLS 328

Human   298 SCYWKEIVHKTNEIMLVLSSF---NSCLDPVMYFLMSSNIRK-----IMC---QLLFRRFQGEPS 351
            ..   ||:     |.|:|.:.   ||.::|::|..:|.|.||     ..|   |.:..:.|.|||
  Fly   329 RL---EIL-----IFLLLGALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQDINAQLQLEPS 385

Human   352  351
              Fly   386  385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR34NP_001091048.1 7tmA_GPR34-like 55..338 CDD:320276 82/311 (26%)
TM helix 1 57..81 CDD:320276 9/24 (38%)
TM helix 2 90..111 CDD:320276 9/20 (45%)
TM helix 3 128..150 CDD:320276 4/21 (19%)
TM helix 4 173..189 CDD:320276 4/15 (27%)
TM helix 5 216..239 CDD:320276 10/25 (40%)
TM helix 6 265..287 CDD:320276 4/29 (14%)
TM helix 7 306..331 CDD:320276 7/27 (26%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 80/299 (27%)
7tm_1 94..353 CDD:278431 72/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.