DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR33 and TkR86C

DIOPT Version :9

Sequence 1:NP_001184113.2 Gene:GPR33 / 2856 HGNCID:4489 Length:333 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:383 Identity:83/383 - (21%)
Similarity:150/383 - (39%) Gaps:111/383 - (28%)


- Green bases have known domain annotations that are detailed below.


Human     4 INSTDYLINASTLVRNS-------------TQFLAPA----------SKMIIALSLYISSIIGTI 45
            :|.|:.:...|:::.|.             |:.|.|:          .|.|.|:...:...:...
  Fly    35 LNRTEVVSLLSSIIDNRDNLESINEAKDFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIA 99

Human    46 TNGLYLWVLR-FKMKQTVNTLLFFHLILSYFISTMILPFMATSQLQ---------DNHWNFGTAL 100
            .||:.||::. .:..:||.         :||:..:.:..:..|.|.         ::.|.||:..
  Fly   100 GNGIVLWIVTGHRSMRTVT---------NYFLLNLSIADLLMSSLNCVFNFIFMLNSDWPFGSIY 155

Human   101 CKVFNGTLSLGMFTSVFFLSAIGLDRYLLTLHPVWSQQHRTPRWASSIVLG-VWISAAALSIPYL 164
            |.:.|...::.:.||||.|.||..|||:..:||:   :.||.|....|:|. :|..:..||.|.|
  Fly   156 CTINNFVANVTVSTSVFTLVAISFDRYIAIVHPL---KRRTSRRKVRIILVLIWALSCVLSAPCL 217

Human   165 IFRE--THHDRKGKVTCQNNYAVSTNWESKEMQASRQWIHVACFI----SRF------------- 210
            ::..  |.|...||                    ||    ..||:    .|:             
  Fly   218 LYSSIMTKHYYNGK--------------------SR----TVCFMMWPDGRYPTSMADYAYNLII 258

Human   211 -LLGFLLPFFIIIFCY---------ERVASKVKERSL--FKSSKPFKVMMTAIISFF-VCWMPYH 262
             :|.:.:|..:::.||         .|...:..:|.:  .||.:....|..||:|.| :||:|||
  Fly   259 LVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYH 323

Human   263 I------HQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTLYLFVGENFKKVFKKSI 314
            :      |...:.:|.....:.|......::   |.:.:|.:|.::.:.|:..|::.|
  Fly   324 LFFIYAYHNNQVASTKYVQHMYLGFYWLAMS---NAMVNPLIYYWMNKRFRMYFQRII 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR33NP_001184113.2 7tm_1 47..265 CDD:278431 64/266 (24%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 72/322 (22%)
7tm_1 100..363 CDD:278431 69/301 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.