DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PXD2B and piki-1

DIOPT Version :9

Sequence 1:XP_016864840.1 Gene:SH3PXD2B / 285590 HGNCID:29242 Length:939 Species:Homo sapiens
Sequence 2:NP_510529.1 Gene:piki-1 / 181618 WormBaseID:WBGene00009552 Length:1607 Species:Caenorhabditis elegans


Alignment Length:189 Identity:43/189 - (22%)
Similarity:83/189 - (43%) Gaps:21/189 - (11%)


- Green bases have known domain annotations that are detailed below.


Human     7 IVEVKVLDVQKRRVPNKHYVYIIRVTWSSGSTEA-IYRRYSKFFDLQMQMLDKFPMEGGQKDPKQ 70
            |..|.||..:|..:|||.|:|.:.|...:.:..: |||.:::|.:|..::..:|||.....:...
 Worm  1346 ISRVTVLKFEKHCIPNKIYMYKVEVHRKNVAVSSFIYRSFAEFEELHTKLRARFPMMAVSLNTIS 1410

Human    71 RIIPFLPGKILFRRSHIRDVAVKRLIPIDEYCKALIQLPPYISQCDEVLQFFETRPEDLNPPKEE 135
            .:           ||::|.||.||:|.:.::...|......|..||.|..||.:...|       
 Worm  1411 NL-----------RSNVRAVAQKRIIHVQKFLIYLFNQVDEICHCDLVYTFFHSILRD------- 1457

Human   136 HIGKKKSGGDQTSVDPMVLEQYVVVANYQKQESSEISLSVGQVVDIIEKNESGWWFVST 194
              .|..:..|::...|...:.|:.:.....:|:..:.:...:.:.:::.|:....:|.|
 Worm  1458 --NKCDTYIDESLDMPSQCQIYLKIEYNSVKETLSVFIGHAKYLALLQNNQQPDPYVKT 1514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PXD2BXP_016864840.1 None
piki-1NP_510529.1 PI3K_rbd 348..456 CDD:197540
C2A_PI3K_class_II 593..775 CDD:175979
PI3Ka_II 784..948 CDD:238441
PI3Kc_II 964..1315 CDD:270710
PX_domain 1346..1454 CDD:295365 34/118 (29%)
C2B_PI3K_class_II 1473..1604 CDD:176027 5/42 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.