DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPER1 and Dop1R1

DIOPT Version :9

Sequence 1:NP_001035055.1 Gene:GPER1 / 2852 HGNCID:4485 Length:375 Species:Homo sapiens
Sequence 2:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster


Alignment Length:424 Identity:102/424 - (24%)
Similarity:169/424 - (39%) Gaps:99/424 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    15 YPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNIL 79
            |.||...:..|.:| ..|.|.  :.|.:......||.....|:|:|||.|  |||   ...||||
  Fly    92 YDGTTLTSFYNESS-WTNASE--MDTIVGEEPEPLSLVSIVVVGIFLSVL--IFL---SVAGNIL 148

Human    80 ILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVF----NLHERYYDIAVLCTFMSLFLQVN 140
            :.:...:.|....|.:|:..:||:|||.:.  ||:..|    :|...:...|..|.....|..:.
  Fly   149 VCLAIYTERSLRRIGNLFLASLAIADLFVA--SLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMC 211

Human   141 MYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEAC 205
            ..:|:..|..:|.||||.:...:|...:.|:..|.::...||:.:...:.||. ::.:...|:..
  Fly   212 STASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPI-SLGIHRPDQPL 275

Human   206 F----------CFADVREV-QWLEVTLGFIVPFAI-IGL-----CYS----LIVRVLVR------ 243
            .          |..|:... ..:...:.|..|..: ||:     ||:    ..::.:.|      
  Fly   276 IFEDNGKKYPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAE 340

Human   244 AHRHRGL-RPRRQ---------------------KALRMILAVVLVFFVCWLPENVFISVHLLQR 286
            ..|::.: ||:.|                     ||...:..::.||.:||:|   |..|::.  
  Fly   341 KQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVP---FFCVNIT-- 400

Human   287 TQPGAAPCK-----QSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKT--- 343
                ||.||     |:|:        |:....:|||..||:|||...:.|||..:..:..:.   
  Fly   401 ----AAFCKTCIGGQTFK--------ILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNPWC 453

Human   344 ------NLPALN--RFC--HAALKAVIPDSTEQS 367
                  |:...|  ||.  :||...|:.:|...|
  Fly   454 CAQDVGNIHPRNSDRFITDYAAKNVVVMNSGRSS 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPER1NP_001035055.1 7tmA_GPER1 60..335 CDD:320120 81/332 (24%)
TM helix 1 62..86 CDD:320120 9/23 (39%)
TM helix 2 95..116 CDD:320120 8/20 (40%)
TM helix 3 131..153 CDD:320120 3/21 (14%)
TM helix 4 176..192 CDD:320120 2/15 (13%)
TM helix 5 212..235 CDD:320120 5/29 (17%)
TM helix 6 258..280 CDD:320120 6/21 (29%)
TM helix 7 303..328 CDD:320120 9/24 (38%)
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 40/139 (29%)
7tm_1 145..431 CDD:278431 68/305 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.