Sequence 1: | NP_001035055.1 | Gene: | GPER1 / 2852 | HGNCID: | 4485 | Length: | 375 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027122.2 | Gene: | CNMaR / 39127 | FlyBaseID: | FBgn0053696 | Length: | 480 | Species: | Drosophila melanogaster |
Alignment Length: | 237 | Identity: | 57/237 - (24%) |
---|---|---|---|
Similarity: | 89/237 - (37%) | Gaps: | 62/237 - (26%) |
- Green bases have known domain annotations that are detailed below.
Human 25 NTTSPELNLSHPLLGTALANGTGELSEHQQ--YVIGLFLSCLYTIFLFPIGFVGNILILVVNISF 87
Human 88 REKMTIPDLYFINLAVADLILVADSLIEVFN-LHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWM 151
Human 152 SFDRYIA----LARAMRCSLFRTKHHARLSC----GL------------IWMASVSATL------ 190
Human 191 ------------------VPFTAVHLQHTDEAC--FCFADVR 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GPER1 | NP_001035055.1 | 7tmA_GPER1 | 60..335 | CDD:320120 | 47/200 (24%) |
TM helix 1 | 62..86 | CDD:320120 | 8/23 (35%) | ||
TM helix 2 | 95..116 | CDD:320120 | 6/20 (30%) | ||
TM helix 3 | 131..153 | CDD:320120 | 5/21 (24%) | ||
TM helix 4 | 176..192 | CDD:320120 | 5/55 (9%) | ||
TM helix 5 | 212..235 | CDD:320120 | 1/1 (100%) | ||
TM helix 6 | 258..280 | CDD:320120 | |||
TM helix 7 | 303..328 | CDD:320120 | |||
CNMaR | NP_001027122.2 | 7tm_4 | 73..>262 | CDD:304433 | 44/187 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |