| Sequence 1: | NP_001035055.1 | Gene: | GPER1 / 2852 | HGNCID: | 4485 | Length: | 375 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001379889.1 | Gene: | frpr-10 / 186481 | WormBaseID: | WBGene00019019 | Length: | 292 | Species: | Caenorhabditis elegans |
| Alignment Length: | 260 | Identity: | 56/260 - (21%) |
|---|---|---|---|
| Similarity: | 103/260 - (39%) | Gaps: | 56/260 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Human 108 LVADSLIEVFNLHER-----------YYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALAR 161
Human 162 AMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQ----------- 215
Human 216 WLEVTLGFIVPFAIIGLCYSLI---VRVLVRA-----HRHRGLRPRRQKALR----MILAVVLVF 268
Human 269 FVCWLPENVFISVHLLQR-TQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFR 332
Human 333 332 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GPER1 | NP_001035055.1 | 7tmA_GPER1 | 60..335 | CDD:320120 | 56/260 (22%) |
| TM helix 1 | 62..86 | CDD:320120 | |||
| TM helix 2 | 95..116 | CDD:320120 | 1/7 (14%) | ||
| TM helix 3 | 131..153 | CDD:320120 | 5/21 (24%) | ||
| TM helix 4 | 176..192 | CDD:320120 | 3/15 (20%) | ||
| TM helix 5 | 212..235 | CDD:320120 | 6/33 (18%) | ||
| TM helix 6 | 258..280 | CDD:320120 | 5/25 (20%) | ||
| TM helix 7 | 303..328 | CDD:320120 | 8/24 (33%) | ||
| frpr-10 | NP_001379889.1 | 7tmA_FMRFamide_R-like | <20..242 | CDD:410630 | 53/241 (22%) |
| TM helix 3 | 32..54 | CDD:410630 | 6/24 (25%) | ||
| TM helix 4 | 77..93 | CDD:410630 | 3/15 (20%) | ||
| TM helix 5 | 119..142 | CDD:410630 | 5/22 (23%) | ||
| TM helix 6 | 177..199 | CDD:410630 | 4/24 (17%) | ||
| TM helix 7 | 210..235 | CDD:410630 | 9/28 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||