DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPER1 and ser-1

DIOPT Version :9

Sequence 1:NP_001035055.1 Gene:GPER1 / 2852 HGNCID:4485 Length:375 Species:Homo sapiens
Sequence 2:NP_001024728.1 Gene:ser-1 / 181716 WormBaseID:WBGene00004776 Length:683 Species:Caenorhabditis elegans


Alignment Length:502 Identity:85/502 - (16%)
Similarity:145/502 - (28%) Gaps:250/502 - (49%)


- Green bases have known domain annotations that are detailed below.


Human    12 LEMYPGTAQPAAP-----------NTTSPELNLSH---------PLLGTALANGTGELSEHQQYV 56
            :|::..:|.|..|           ...:|..:.:.         |.:|....||           
 Worm     3 IELFSHSAPPEDPYYVPANESFATTALTPHFSTTSVWSIRVQLIPTMGIYHFNG----------- 56

Human    57 IGLFL---SCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFN 118
            :.|||   .||       ||.:||.|:.|...:.|....:.:.:..:||:|||:           
 Worm    57 VALFLLPVLCL-------IGLIGNFLVCVAIATDRRLHNVTNYFLFSLALADLL----------- 103

Human   119 LHERYYDIAVLCTFMSLFLQVN----------------MYSSVFF-------LTWMSFDRYIALA 160
                     |.|..|.|.:.|.                :||.||.       ::.:|.|||:.::
 Worm   104 ---------VCCIVMPLSIVVEVRHGVWTWSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGIS 159

Human   161 RAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHT-----DEACFCFADVREVQWLEVT 220
            :.:| :..|:|....:...::|:.::..: .|...:.:..|     :..|..|:  |.......|
 Worm   160 QPLR-TRNRSKTLIFIKIAIVWVVTLLVS-CPIAVLAMHDTANILRNNQCMIFS--RYYIIYGST 220

Human   221 LGFIVPFAIIGLCYSLIVRVL----------------------VRAHRHRGL------------- 250
            :.|::|..|:|:.|:...::|                      ...||..|.             
 Worm   221 MTFLIPLCIMGVTYAKTTQLLNKQASILSQKAGDKFNGNGLRRTMPHRKLGYARTYSATVNGTIA 285

Human   251 ------------------------------RP--------------------------------- 252
                                          ||                                 
 Worm   286 NGKAIGAHGRTMSSISNIANGETADRLGTSRPSINTNGHKQLQKASTINKWKSRTSNLVTNFANK 350

Human   253 --RR-------------QKALRMILAVVLVFFVCWLP------------ENVFI-----SVHLLQ 285
              ||             .||.|::..|...||:||.|            |||.|     |:.|  
 Worm   351 VGRRSSLQTATQDLANEHKATRVLAVVFACFFICWTPFFFINFLIGFGGENVQIPDWVASIFL-- 413

Human   286 RTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFR 332
                              ..|::       :|.:||:||:...:.||
 Worm   414 ------------------WLGYV-------SSTINPIIYTVFNKRFR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPER1NP_001035055.1 7tmA_GPER1 60..335 CDD:320120 75/434 (17%)
TM helix 1 62..86 CDD:320120 8/23 (35%)
TM helix 2 95..116 CDD:320120 5/20 (25%)
TM helix 3 131..153 CDD:320120 7/44 (16%)
TM helix 4 176..192 CDD:320120 1/15 (7%)
TM helix 5 212..235 CDD:320120 6/22 (27%)
TM helix 6 258..280 CDD:320120 11/38 (29%)
TM helix 7 303..328 CDD:320120 6/24 (25%)
ser-1NP_001024728.1 7tmA_5-HT2 56..438 CDD:320180 77/449 (17%)
TM helix 1 57..83 CDD:320180 11/32 (34%)
TM helix 2 90..116 CDD:320180 9/45 (20%)
TM helix 3 129..159 CDD:320180 8/29 (28%)
TM helix 4 170..193 CDD:320180 2/23 (9%)
TM helix 5 211..240 CDD:320180 7/30 (23%)
TM helix 6 365..395 CDD:320180 9/29 (31%)
TM helix 7 406..431 CDD:320180 8/51 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.