DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPER1 and dop-1

DIOPT Version :9

Sequence 1:NP_001035055.1 Gene:GPER1 / 2852 HGNCID:4485 Length:375 Species:Homo sapiens
Sequence 2:NP_001370620.1 Gene:dop-1 / 180714 WormBaseID:WBGene00001052 Length:460 Species:Caenorhabditis elegans


Alignment Length:445 Identity:91/445 - (20%)
Similarity:144/445 - (32%) Gaps:148/445 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    49 LSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPD-LYFINLAVADLIL-VAD 111
            :::.|..::||| |.|..:.||     ||:|:....:..|.....|: |:.::|||:||:: |..
 Worm     1 MNDLQWPLLGLF-SVLIILALF-----GNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLV 59

Human   112 SLIEVFNLHERYYDIA-VLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHAR 175
            .|....|....|:... ..|.|...|......:|:..|..:|.|||..::|.|....:..:....
 Worm    60 MLFAAVNDILGYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRIN 124

Human   176 LSCGLIWMAS------------------------------------VSATLVPF----------- 193
            ....|:|:.|                                    :.:::|.|           
 Worm   125 YVIVLVWLISAGIGAAPLGFGFGSKVTINNLTGLPVCEMRLPLPYAIGSSMVSFFLPAMVMVILY 189

Human   194 TAVHL-----------QHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRH 247
            |.::|           |......|....:...:..|||...:...|::........|..:...||
 Worm   190 TKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIREVTAATLKGEALLPPDSPATERTTMTVSRH 254

Human   248 RGLR---------PRR------------------------------------------------- 254
            ...|         |||                                                 
 Worm   255 YSRRSTTTTTTATPRRGDKKTSSQNKVESIRTSIFSKLNFLCPTRFKNQRSPQDPHTPAAHNRSN 319

Human   255 ---QKALRMILAVVL-VFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFS 315
               ||| |:.|.|:: .|.|||||   |.:|::|:...|.....|         |...|....::
 Worm   320 ISDQKA-RLTLGVIMGTFLVCWLP---FFTVNILRAWLPEIFSSK---------TIMAVTWLGYA 371

Human   316 NSCLNPLIYSFLGETFRDKLRLYIEQKTNL----PALNRFCHAALKAVIPDSTEQ 366
            ||..||||||.....||...:..|.:....    |.||:...:...|  ||:.|:
 Worm   372 NSSANPLIYSIFNRDFRRAFKKIIVRVFGCCWEEPDLNKSISSRYAA--PDNIER 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPER1NP_001035055.1 7tmA_GPER1 60..335 CDD:320120 80/397 (20%)
TM helix 1 62..86 CDD:320120 7/23 (30%)
TM helix 2 95..116 CDD:320120 8/22 (36%)
TM helix 3 131..153 CDD:320120 4/21 (19%)
TM helix 4 176..192 CDD:320120 3/51 (6%)
TM helix 5 212..235 CDD:320120 4/22 (18%)
TM helix 6 258..280 CDD:320120 10/22 (45%)
TM helix 7 303..328 CDD:320120 10/24 (42%)
dop-1NP_001370620.1 7tmA_Ap5-HTB1-like 7..391 CDD:320193 82/402 (20%)
TM helix 1 8..32 CDD:320193 10/29 (34%)
TM helix 2 42..64 CDD:320193 8/21 (38%)
TM helix 3 80..102 CDD:320193 4/21 (19%)
TM helix 4 125..141 CDD:320193 3/15 (20%)
TM helix 5 167..190 CDD:320193 2/22 (9%)
TM helix 6 326..348 CDD:320193 11/24 (46%)
TM helix 7 359..384 CDD:320193 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.