DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPER1 and npr-25

DIOPT Version :9

Sequence 1:NP_001035055.1 Gene:GPER1 / 2852 HGNCID:4485 Length:375 Species:Homo sapiens
Sequence 2:NP_505883.1 Gene:npr-25 / 179570 WormBaseID:WBGene00011381 Length:376 Species:Caenorhabditis elegans


Alignment Length:397 Identity:83/397 - (20%)
Similarity:144/397 - (36%) Gaps:100/397 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    36 PLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILIL----VVNISFREKMTI--- 93
            ||:|.:.|.                .:..|:| .|..|.:||..:|    .:..|.:..:|.   
 Worm    14 PLVGASFAK----------------TAIPYSI-CFVFGTLGNTAVLSYVFFITRSLKSSVTALGN 61

Human    94 PDLYFINLAVADLILVADSLIEV-FNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYI 157
            ..:|.:.|...||::.......: :.:...:....::|....:....|...|.|.||.::||||:
 Worm    62 TFIYIVALCAVDLLVTVSIPFSLSYMILNNWVFGELVCKIHFMLELSNKMCSTFILTALAFDRYM 126

Human   158 ALA-------RAMRCSLFRTKHHARLSCGLIWMASVSATLVPF-------TAVHLQHTDEACFCF 208
            |:.       ..||.:::.|...|.||..||....:||.:..|       :|.:.:|......|.
 Worm   127 AICHPEIKRIHEMRHTIYITTILATLSLFLISPVVLSARVTSFKSGQYFVSAKNERHEVIRQMCI 191

Human   209 ADVREVQWLEVTLGFIVPFAIIGLCYSL---IVRVLVRAHRHRGLRPRRQKALRMI----LAVVL 266
             |...::|......|::.||.:..|..|   ..::::|..|.|....:.:..||.|    :|...
 Worm   192 -DGMALEWKVWVSAFLIFFAFLLPCTLLTYFYAKIVLRLRRQRRTMLQSRIPLRRITIYTMAATF 255

Human   267 VFFVC----WLPE--NVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVN-----------LAAF 314
            .:..|    |||:  |:|.:|                       .||.:|           |..|
 Worm   256 FYLSCHIPFWLPQIYNIFSTV-----------------------LGHKMNPKVMTFTYYSHLLPF 297

Human   315 SNSCLNPLIYSFLGETFRDKLRL----YIEQKTNLPALNRFCHAALK---------AVIPDSTEQ 366
            .::..|.:.|:.|...|:..|.|    .|.::|.......:..||::         .:.|....|
 Worm   298 ISAAFNWIFYARLNSQFKKGLVLVTERMIRKRTKSMHEKGYSEAAVELTSKFDDVPLMCPHCEAQ 362

Human   367 SDVRFSS 373
            ..:|.||
 Worm   363 LSIRSSS 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPER1NP_001035055.1 7tmA_GPER1 60..335 CDD:320120 68/320 (21%)
TM helix 1 62..86 CDD:320120 7/27 (26%)
TM helix 2 95..116 CDD:320120 4/20 (20%)
TM helix 3 131..153 CDD:320120 5/21 (24%)
TM helix 4 176..192 CDD:320120 6/15 (40%)
TM helix 5 212..235 CDD:320120 5/22 (23%)
TM helix 6 258..280 CDD:320120 10/31 (32%)
TM helix 7 303..328 CDD:320120 7/35 (20%)
npr-25NP_505883.1 7tm_classA_rhodopsin-like 24..311 CDD:381740 66/311 (21%)
TM helix 1 24..48 CDD:381740 7/24 (29%)
TM helix 2 63..84 CDD:381740 4/20 (20%)
TM helix 3 100..122 CDD:381740 5/21 (24%)
TM helix 4 144..160 CDD:381740 6/15 (40%)
TM helix 5 200..223 CDD:381740 5/22 (23%)
TM helix 6 244..269 CDD:381740 7/24 (29%)
TM helix 7 286..311 CDD:381740 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.