| Sequence 1: | NP_001035055.1 | Gene: | GPER1 / 2852 | HGNCID: | 4485 | Length: | 375 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001256126.1 | Gene: | dop-2 / 179347 | WormBaseID: | WBGene00001053 | Length: | 849 | Species: | Caenorhabditis elegans |
| Alignment Length: | 264 | Identity: | 56/264 - (21%) |
|---|---|---|---|
| Similarity: | 114/264 - (43%) | Gaps: | 52/264 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Human 10 VGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLY---TIFLFP 71
Human 72 -IGFVGNILILVVNISFREKMTIPDLYFINLAVADL---ILVADSLIEVFNLHERYYDIAVLCTF 132
Human 133 MSLFLQVNM---YSSVFFLTWMSFDRYIALARAMRCSLFRTKHHAR---LSCGLIWMASVSATLV 191
Human 192 PFTAVHLQHTD----EACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRP 252
Human 253 RRQK 256 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GPER1 | NP_001035055.1 | 7tmA_GPER1 | 60..335 | CDD:320120 | 47/214 (22%) |
| TM helix 1 | 62..86 | CDD:320120 | 6/27 (22%) | ||
| TM helix 2 | 95..116 | CDD:320120 | 8/23 (35%) | ||
| TM helix 3 | 131..153 | CDD:320120 | 2/24 (8%) | ||
| TM helix 4 | 176..192 | CDD:320120 | 3/15 (20%) | ||
| TM helix 5 | 212..235 | CDD:320120 | 4/22 (18%) | ||
| TM helix 6 | 258..280 | CDD:320120 | |||
| TM helix 7 | 303..328 | CDD:320120 | |||
| dop-2 | NP_001256126.1 | 7tmA_D2-like_dopamine_R | 38..>233 | CDD:320181 | 44/204 (22%) |
| TM helix 1 | 40..64 | CDD:320181 | 5/23 (22%) | ||
| TM helix 2 | 73..95 | CDD:320181 | 8/21 (38%) | ||
| TM helix 3 | 112..134 | CDD:320181 | 2/21 (10%) | ||
| TM helix 4 | 158..174 | CDD:320181 | 3/15 (20%) | ||
| TM helix 5 | 195..218 | CDD:320181 | 5/25 (20%) | ||
| 7tm_GPCRs | <745..828 | CDD:421689 | |||
| TM helix 6 | 751..781 | CDD:410628 | |||
| TM helix 7 | 796..821 | CDD:410628 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||