DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DLL1 and Ser

DIOPT Version :9

Sequence 1:NP_005609.3 Gene:DLL1 / 28514 HGNCID:2908 Length:723 Species:Homo sapiens
Sequence 2:NP_001287558.1 Gene:Ser / 43275 FlyBaseID:FBgn0004197 Length:1407 Species:Drosophila melanogaster


Alignment Length:689 Identity:233/689 - (33%)
Similarity:304/689 - (44%) Gaps:188/689 - (27%)


- Green bases have known domain annotations that are detailed below.


Human     3 SRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPP---------CA-CR 57
            |.|.|...:|..|:.::.::|.|||::.|..|....|.|..||    |.|.         |: |.
  Fly    64 SACNLIALILILLVHKISAAGNFELEILEISNTNSHLLNGYCC----GMPAELRATKTIGCSPCT 124

Human    58 TFFRVCLKHYQ-----ASVSPEPPCTYGSAVTPVLGVDSFSLPDGG-GADSAFSNPIRFPFGFTW 116
            |.||:|||.||     ||:|  ..|::|:|.|.:||..||.|.|.| ||       |..||.|.|
  Fly   125 TAFRLCLKEYQTTEQGASIS--TGCSFGNATTKILGGSSFVLSDPGVGA-------IVLPFTFRW 180

Human   117 PGTFSLIIEAL---HTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFV 178
            ..:|:||::||   :|..||      .||||...:....:....||....|......:.|..|..
  Fly   181 TKSFTLILQALDMYNTSYPD------AERLIEETSYSGVILPSPEWKTLDHIGRNARITYRVRVQ 239

Human   179 CDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGEC 243
            |...||...|:.|||||||.|||:.||..|:|:|..||:|..|.|.||..|||..||.||:||||
  Fly   240 CAVTYYNTTCTTFCRPRDDQFGHYACGSEGQKLCLNGWQGVNCEEAICKAGCDPVHGKCDRPGEC 304

Human   244 KCRVGWQGRYCDECIRYPGCLHGTCQ-QPWQCNCQEGWGGLFCNQDLNYCTHHKPCKNGATCTNT 307
            :||.||:|..|:||:.||||.||:|. ..|:|.|...|||:.|:||||:|..|:|||:|.||.||
  Fly   305 ECRPGWRGPLCNECMVYPGCKHGSCNGSAWKCVCDTNWGGILCDQDLNFCGTHEPCKHGGTCENT 369

Human   308 ----------------------------------------------------------------- 307
                                                                             
  Fly   370 APDKYRCTCAEGLSGEQCEIVEHPCATRPCRNGGTCTLKTSNRTQAQVYRTSHGRSNMGRPVRRS 434

Human   308 ------------GQ-------------GS----------YTCSCRPGYTGATCELGIDECDPSPC 337
                        ||             ||          :||.|..|:||.|||:.||||...||
  Fly   435 SSMRSLDHLRPEGQALNGSSSPGLVSLGSLQLQQQLAPDFTCDCAAGWTGPTCEINIDECAGGPC 499

Human   338 KNGGSCTDLENSYSCTCPPGFYGKICELSAMTC-------------------------------- 370
            ::||:|.||...:.|.|||.::|.:|::....|                                
  Fly   500 EHGGTCIDLIGGFRCECPPEWHGDVCQVDVNECEAPHSAGIAANALLTTTATAIIGSNLSSTALL 564

Human   371 ------------ADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKCVDL 423
                        |.|||.|...|.:.| |.::|.|..|:.|..|.:.:|.|... |.|||.|:||
  Fly   565 AALTSAVASTSLAIGPCINAKECRNQP-GSFACICKEGWGGVTCAENLDDCVGQ-CRNGATCIDL 627

Human   424 GDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHA 488
            .:.|.|.|.:||.||.|:.::|:||:|||.|||.|.|.|..|:|.||.||:|..|......|..:
  Fly   628 VNDYRCACASGFKGRDCETDIDECATSPCRNGGECVDMVGKFNCICPLGYSGSLCEEAKENCTPS 692

Human   489 PCHNGATCHERGHRYVCECARGYGGPNCQFLLP--ELPP 525
            ||..| .|......|.|.|.....|.:|:.|.|  ..||
  Fly   693 PCLEG-HCLNTPEGYYCHCPPDRAGKHCEQLRPLCSQPP 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DLL1NP_005609.3 MNNL 22..92 CDD:311545 31/84 (37%)
DSL 159..221 CDD:128366 26/61 (43%)
EGF_CA 288..326 CDD:238011 24/137 (18%)
EGF_CA 329..364 CDD:238011 16/34 (47%)
EGF_CA <373..403 CDD:238011 11/29 (38%)
EGF_CA 406..440 CDD:238011 16/33 (48%)
EGF_CA 443..478 CDD:238011 19/34 (56%)
EGF_CA <489..517 CDD:238011 8/27 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 653..702
Interaction with MAGI1. /evidence=ECO:0000250|UniProtKB:Q61483 720..723
SerNP_001287558.1 MNNL 83..161 CDD:284966 31/83 (37%)
DSL 220..282 CDD:279722 26/61 (43%)
EGF_CA 350..388 CDD:238011 13/37 (35%)
EGF_CA 490..526 CDD:238011 16/35 (46%)
EGF_CA 610..645 CDD:238011 16/35 (46%)
EGF_CA 647..683 CDD:238011 19/35 (54%)
EGF_CA 798..833 CDD:238011
EGF_CA 879..913 CDD:238011
EGF_CA 916..952 CDD:238011
VWC_out <993..1053 CDD:214565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D197806at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.