DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDH19 and CadN2

DIOPT Version :9

Sequence 1:NP_066976.1 Gene:CDH19 / 28513 HGNCID:1758 Length:772 Species:Homo sapiens
Sequence 2:NP_001036368.2 Gene:CadN2 / 35071 FlyBaseID:FBgn0262018 Length:1799 Species:Drosophila melanogaster


Alignment Length:729 Identity:191/729 - (26%)
Similarity:316/729 - (43%) Gaps:125/729 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    69 DLDNGNNSFQYKLLGAG------AGSTFIIDERTGDIYAIQKLDREERS-----LYILRAQVIDI 122
            |:|...| ..|.|.|.|      |.|.|.|:..||||:.::.|||::.:     .:.:.||   .
  Fly   166 DVDRPIN-IVYFLTGQGIDPDNPANSKFDINRTTGDIFVLKPLDRDQPNGRPQWRFTVFAQ---D 226

Human   123 ATGRAVEPESEFVIKVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLL 187
            ..|..:...::..:.:.|||||.|:|....|...|.|....|:.|:.::|.|.|||:...||:|:
  Fly   227 EGGEGLVGYADIQVNLKDINDN
APQFPQGIYFGNVTENGTAGSSVMTMSAVDYDDPNESTNAKLI 291

Human   188 YSLLQ-------GQPYFSVEPTTGVIRIS-SKMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLI 244
            ||:.:       |.|.|.:||.||:|:.: ..:|||...:|.:.:.|.|    .|.|.||.:..|
  Fly   292 YSIEKNVIEEETGAPIFEIEPETGLIKTAVCCLDRERTPDYSIQVVAMD----GGGLKGTGTASI 352

Human   245 KLSDVNDNKPIFKESLYRLTVSESAPT---GTSIGTIMAYDNDIGENAEMDYSIEEDD---SQTF 303
            ::.|:||..|.|.:..:...|.|:..|   .|.|.|:...|.|  |.....|.:..:.   :..|
  Fly   353 RVKDLND
MPPQFTKDEWVTEVDETNGTYIPETPILTVTVQDED--ETNTFQYKVVPNSGFGADKF 415

Human   304 DIITNHETQEGIVILKKKVDFE---HQNHYGIRAKV--KNHHVPEQLMKYHTEASTTFIKIQVED 363
            .::.|.:....:.|: :.:|:|   ..:.:..|.:|  |....|....|||...|...:|::  |
  Fly   416 AMVRNGDGTGSLKII-QPLDYEDPLQSSGFRFRIQVNDKGDDGPGGSDKYHVAYSWVVVKLR--D 477

Human   364 V-DEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPD-NRKSPIRYSITRS----KVFNINDNGTI 422
            : |..|.|...:....::|:|..|:.:....|||.| ...|.:.|.|.||    :.|.|:|.|.:
  Fly   478 INDN
VPKFDREHIEVSIYEDTKVGTILEQFKATDADQGGHSKVAYKIVRSTNRKRQFAISDRGAV 542

Human   423 TTSNSLDREISAWYNLSITATEKYNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQV 487
            :....||||....:::.|.|.:..:..:.::..|.|.|.::||:||.|:|.|:..:.||. ||:.
  Fly   543 SIQRPLDRETQDRHHIQILAIDDGSPARTATATLTVIVKDVNDN
APTFAQDYKPTLPENV-SGKK 606

Human   488 IQTISAVDRDESIEEH--HFYFNLS--VEDTNNSSFTII-----DNQDNTAVILTNRTGFNLQEE 543
            |..::|.|.|:.:..:  .|.|.|.  ..|...:.|.:.     ||::..|:|.:.|. |:.:.:
  Fly   607 ILEVAAKDPDDRLRGNGGPFTFRLDPLASDEIKAGFKVEYDRRGDNENGVAIISSLRP-FDREAQ 670

Human   544 PVFYISILIADNGIPSLTSTNTLTIHVCDCGDS---------------GSTQTC----------- 582
            ..:.|.|.|.|||.|::|.|:|||:.:.|..|:               |.:|..           
  Fly   671 KSYAIPIEIKDNGAPAMTGTSTLTVTIGDVNDNKMQPGSKSVLVYNYQGQSQDTPIGRVYVNDPD 735

Human   583 --------QYQELVLSMGFKTEVIIAILICIMIIFGFIFLTLGLKQRRKQILFPEKSEDFRENIF 639
                    .|.|:.....||.:....||.          :..|.::.|.|:.|.           
  Fly   736 DWDVPDKKYYWEVQEHQRFKLDTDTGILT----------MRAGTRRGRYQLRFK----------- 779

Human   640 QYDDEGGGEEDTEA---FDIAELRSSTIMRE---RKTRKTTSAEIRSLYRQSLQVGPDS-AIFRK 697
            .||.| .|:||..|   ..:.::.:..:.:.   |.:..|....:|:......||.|.. ..||.
  Fly   780 VYDRE-HGQEDIPANLSVTVRDITAEAVQQAGSMRLSHITDEDFVRTWNPVKNQVEPSKLERFRN 843

Human   698 FILEKL--EEANTD 709
            .:.|.|  :..|.|
  Fly   844 KLAELLYTDRDNVD 857

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDH19NP_066976.1 Cadherin_repeat 49..144 CDD:206637 24/85 (28%)
Cadherin_repeat 152..252 CDD:206637 36/107 (34%)
Cadherin_repeat 261..366 CDD:206637 25/116 (22%)
Cadherin_repeat 375..466 CDD:206637 26/95 (27%)
Cadherin_repeat 474..572 CDD:206637 32/106 (30%)
Cadherin_C 627..765 CDD:279398 20/92 (22%)
CadN2NP_001036368.2 Cadherin_repeat 41..132 CDD:206637
Cadherin_repeat 140..248 CDD:206637 24/85 (28%)
Cadherin_repeat 256..359 CDD:206637 35/106 (33%)
Cadherin_repeat 379..481 CDD:206637 23/106 (22%)
Cadherin_repeat 489..586 CDD:206637 26/96 (27%)
Cadherin_repeat 594..703 CDD:206637 33/110 (30%)
Cadherin_repeat 724..801 CDD:206637 17/98 (17%)
EGF_CA 977..1010 CDD:238011
LamG 1013..1198 CDD:238058
EGF_2 <1233..1259 CDD:285248
Laminin_G_2 1293..1428 CDD:280389
EGF_CA 1497..1535 CDD:238011
Cadherin_C 1583..1719 CDD:279398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.