Sequence 1: | XP_005260765.1 | Gene: | SIRPB2 / 284759 | HGNCID: | 16247 | Length: | 348 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286718.1 | Gene: | CG13506 / 37556 | FlyBaseID: | FBgn0034723 | Length: | 503 | Species: | Drosophila melanogaster |
Alignment Length: | 195 | Identity: | 50/195 - (25%) |
---|---|---|---|
Similarity: | 79/195 - (40%) | Gaps: | 35/195 - (17%) |
- Green bases have known domain annotations that are detailed below.
Human 135 EHSEMKSDEGTSVL--VKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTVLGDGPPGPIRWFQGA 197
Human 198 GLSREAIYNFGGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQGTSLK 262
Human 263 VKAK-STSSKEAEFTSEPATEMSPTGE------RTHL----------SGVNESPTGKGAMNGLVM 310
Human 311 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SIRPB2 | XP_005260765.1 | V-set | 43..149 | CDD:284989 | 3/15 (20%) |
IG_like | 46..149 | CDD:214653 | 3/15 (20%) | ||
V-set | 163..263 | CDD:284989 | 32/99 (32%) | ||
IG_like | 168..243 | CDD:214653 | 26/74 (35%) | ||
CG13506 | NP_001286718.1 | IG_like | 79..146 | CDD:214653 | 27/77 (35%) |
IGc2 | 83..146 | CDD:197706 | 26/73 (36%) | ||
IG_like | 176..254 | CDD:214653 | 9/49 (18%) | ||
Ig | 176..239 | CDD:299845 | 9/49 (18%) | ||
I-set | 258..349 | CDD:254352 | |||
Ig | 275..348 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |