DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SIRPB2 and CG13506

DIOPT Version :9

Sequence 1:XP_005260765.1 Gene:SIRPB2 / 284759 HGNCID:16247 Length:348 Species:Homo sapiens
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:195 Identity:50/195 - (25%)
Similarity:79/195 - (40%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   135 EHSEMKSDEGTSVL--VKGAGDPEPDLWIIQPQELVLGTTGDTVFLNCTVLGDGPPGPIRWFQGA 197
            |:.:...|:.|.::  .|...:.|...:.......|....||.|.|||..........:.|::  
  Fly    44 EYGDDTDDDDTQIIDVTKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYK-- 106

Human   198 GLSREAIYNFGGISHPKETAVQASNNDFSILLQNVSSEDAGTYYCVKFQRKPNRQYLSGQGTSLK 262
              :|..|.|.   .:|....||...|: ||||:|||.||:..|||   :..|.|   ..|.|:|:
  Fly   107 --NRIIIANG---QNPISQRVQCMLNN-SILLRNVSPEDSDDYYC---EILPQR---VRQHTALR 159

Human   263 VKAK-STSSKEAEFTSEPATEMSPTGE------RTHL----------SGVNESPTGKGAMNGLVM 310
            |.|: |....:.:.|....|...  |:      ||:|          :.:|..|:.....||:::
  Fly   160 VGARLSILCDDRDITDRSQTFRQ--GDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVII 222

Human   311  310
              Fly   223  222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SIRPB2XP_005260765.1 V-set 43..149 CDD:284989 3/15 (20%)
IG_like 46..149 CDD:214653 3/15 (20%)
V-set 163..263 CDD:284989 32/99 (32%)
IG_like 168..243 CDD:214653 26/74 (35%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 27/77 (35%)
IGc2 83..146 CDD:197706 26/73 (36%)
IG_like 176..254 CDD:214653 9/49 (18%)
Ig 176..239 CDD:299845 9/49 (18%)
I-set 258..349 CDD:254352
Ig 275..348 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.