DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR21 and CG13579

DIOPT Version :9

Sequence 1:NP_005285.1 Gene:GPR21 / 2844 HGNCID:4476 Length:349 Species:Homo sapiens
Sequence 2:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster


Alignment Length:448 Identity:93/448 - (20%)
Similarity:149/448 - (33%) Gaps:147/448 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    10 SSHPFCLLAFGYLETVNFCLLEVLIIVFLTVLIISGNIIVIFVF----HCAPLLNHHTTSYFIQT 70
            |.|.| :...|..||:     |.::|:.||:.:|..|.:||||.    :.|.:  |....|.:.:
  Fly    25 SGHNF-IAHIGIAETI-----EAVLILVLTLGVIGANCLVIFVINNRRYAAYI--HQQPRYLLTS 81

Human    71 MAYADLFVGVSCVVP--SLSLLHHPLPVEESLTCQIFGFVVSVLKSVSMASLACISIDRYIAITK 133
            :|..||.:|: .:.|  .:..|.|..|..| :.|||...:...|...|...|.|:::|||:....
  Fly    82 LALNDLTIGL-LITPFGLMPALFHCWPYGE-IFCQIQALLRGALSQQSAVILVCMAVDRYMCALH 144

Human   134 PLTYNTLVTPWRLRLCIFLIWLYSTLVF----LPSFFHWGKPGYHGDVFQWCAESWHTDSYFTLF 194
            |..|....:.......:.|.|:.|..||    ||..:::...|.      ...|.:::...:.:.
  Fly   145 PRRYYQHSSKKGCVAILSLTWIISLTVFGFLVLPKGYYFNNTGL------MACEPFYSKPSYRIL 203

Human   195 IVMMLYAPAALIVCFTYFNIFRIC-----------------------------------QQH--- 221
            ....||.|..:::.:.|.:.|.:.                                   |||   
  Fly   204 STCALYFPTTMVLMYCYGSSFHMSRFRLNDPTMPLTAAAHHPHPHPHPTAAQQLQMHQHQQHHQQ 268

Human   222 -----------------------------------------------------------TKDISE 227
                                                                       ||.|..
  Fly   269 AGMHSHLYHGHSHHPSHPSHPNHPNHHGHPHHHGPPVMGHLSMAMSMGLAGMPNMTNKITKKIVP 333

Human   228 RQARFSSQSGETGEVQACPDKRYAMVLFRITSVFYILWLPYIIYFLLESSTGHS-NRFASFLTTW 291
            .|.:  :.||.|....|.           |:..|.::..|:.|..::.:.||.. ..|..||.||
  Fly   334 IQEK--NSSGSTSRSMAA-----------ISLGFIVMVTPWTIQEIVTACTGSKLPPFLDFLVTW 385

Human   292 LAISNSFCNCVIYSLSNSVFQRGLKRLSGAMCTSCASQTTANDPYTVRSKGPLNGCHI 349
            .|:|||..|..:|.|.||.|:|..::|....|.          |:....:.....|||
  Fly   386 TALSNSLWNPFMYWLLNSDFRRMSRQLMPNKCF----------PHEDTPEHKSGCCHI 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR21NP_005285.1 7tm_classA_rhodopsin-like 31..308 CDD:320086 77/384 (20%)
TM helix 1 31..56 CDD:320086 10/28 (36%)
TM helix 2 64..90 CDD:320086 6/27 (22%)
TM helix 3 102..132 CDD:320086 10/29 (34%)
TM helix 4 145..164 CDD:320086 6/22 (27%)
TM helix 5 188..213 CDD:320086 4/24 (17%)
TM helix 6 238..275 CDD:320086 6/36 (17%)
TM helix 7 283..308 CDD:320086 12/24 (50%)
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 29/100 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.