DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACTL9 and Act88F

DIOPT Version :9

Sequence 1:NP_848620.3 Gene:ACTL9 / 284382 HGNCID:28494 Length:416 Species:Homo sapiens
Sequence 2:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster


Alignment Length:371 Identity:153/371 - (41%)
Similarity:232/371 - (62%) Gaps:5/371 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    50 GAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGLQTFIG-EAARVLPELTLVQP 113
            ||:|||.|:|.||.||||..:|.....:|:|....:....|.....:::| ||......|||..|
  Fly     7 GALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYP 71

Human   114 LRSGIVVDWDAAELIWRHLLEHDLRVATHDHPLLFSDPPFSPATNREKLVEVAFESLRSPAMYVA 178
            :..||:.:||..|.||.|...::||||..:||:|.::.|.:|..||||:.::.||:..|||||||
  Fly    72 IEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVA 136

Human   179 SQSVLSVYAHGRVSGLVVDTGHGVTYTVPVFQGYNLLHATERLDLAGNNLTAFLAEMLLQAGLPL 243
            .|:|||:||.||.:|:|:|:|.||::|||:::|:.|.||..||||||.:||.:|.::|.:.|...
  Fly   137 IQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTERGYSF 201

Human   244 -GQQDLDLVENIKHHYCYVASDFQKEQ--ARPEQEYKRTLKLPDGRTVTLGKELFQCPELLFNPP 305
             ...:.::|.:||...||||.||::|.  |......:::.:||||:.:|:|.|.|:|||.||.|.
  Fly   202 TTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFRCPEALFQPS 266

Human   306 EVPGLSPVGLSTMAKQSLRKLSLEMRADLAQNVLLCGGSSLFTGFEGRFRAELLRALPAETHVVV 370
            .: |:...|:......|:.|..:::|.||..|.:|.||::::.|...|.:.|:....|:...:.:
  Fly   267 FL-GMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEITALAPSTIKIKI 330

Human   371 AAQPTRNFSVWIGGSILASLRAFQSCWVLREQYEEQGPYIVYRKCY 416
            .|.|.|.:||||||||||||..||..|:.:::|:|.||.||:|||:
  Fly   331 IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACTL9NP_848620.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
NBD_sugar-kinase_HSP70_actin 49..416 CDD:302596 152/369 (41%)
ACTIN 49..415 CDD:214592 151/368 (41%)
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 152/369 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.