DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BOD1L2 and BOD1

DIOPT Version :10

Sequence 1:NP_001244893.1 Gene:BOD1L2 / 284257 HGNCID:28505 Length:172 Species:Homo sapiens
Sequence 2:NP_001263031.1 Gene:BOD1 / 43352 FlyBaseID:FBgn0039560 Length:1151 Species:Drosophila melanogaster


Alignment Length:125 Identity:53/125 - (42%)
Similarity:79/125 - (63%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    39 IAIIVGQLKSRGLFDSFRRD-CKADVDTKPAYQNLSQKADNFVSTHLDKQEWNPPANDNQLHDGL 102
            |..::.::||:|:||.||.: |.|||||||||||:..:.:..|:..|.||:|.|..|..||.:.|
  Fly     5 IKTLIAEVKSQGVFDEFRFNCCLADVDTKPAYQNVRTQVETAVNDFLAKQQWTPETNKVQLRERL 69

Human   103 RQSVVQSGRSEAGVDRISSQVVDPKLNHIFRPQIEQIIHEFLVAQKEA-----AVPALPP 157
            |:.::.|...:.|||:|..|||:||:..||.|:||.|::::|.....|     :.|.|||
  Fly    70 RKHLMDSDVLDKGVDQIVDQVVNPKVATIFEPKIESIVYKYLGITPPARPTMLSAPPLPP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BOD1L2NP_001244893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
COMPASS-Shg1 42..135 CDD:461586 42/93 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..172 4/7 (57%)
BOD1NP_001263031.1 COMPASS-Shg1 8..102 CDD:461586 42/93 (45%)
LGT <791..927 CDD:469786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.