DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NEK8 and fin1

DIOPT Version :9

Sequence 1:NP_835464.1 Gene:NEK8 / 284086 HGNCID:13387 Length:692 Species:Homo sapiens
Sequence 2:NP_593305.1 Gene:fin1 / 2542237 PomBaseID:SPAC19E9.02 Length:722 Species:Schizosaccharomyces pombe


Alignment Length:290 Identity:100/290 - (34%)
Similarity:151/290 - (52%) Gaps:29/290 - (10%)


- Green bases have known domain annotations that are detailed below.


Human     1 MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNHPNVIE 65
            ||||:.:..:|.|:||.::...|..|..|:..|:|....:|::|:|...:|..:|:.|.|||:::
pombe     1 MEKYKILECIGHGSFGRIYKVQRLKDGALLAQKEIHFGNITRQEKQYIADEVNILRNLKHPNIVQ 65

Human    66 YYENFLEDKALMI--AMEYAPGGTLAEFIQ--KRCNSLLEEETILHFFVQILLALHHVH------ 120
            |....|...|.:|  .|||...|.||..||  |.......|:.:|.||.|:||||:..|      
pombe    66 YCGEELNRSAQVINLYMEYCGHGDLANLIQRYKEEKKRFTEQEVLKFFTQLLLALYRCHYGENAP 130

Human   121 -------------THLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYT--VVGTPCYI 170
                         ...:||||:|..||.||::.. ||:||||:||:|.: ::.:|  .||||.|:
pombe   131 ACDSQWPREIFHPKQSVLHRDIKPANIFLDENNS-VKLGDFGLSKLLDN-TRVFTQSYVGTPYYM 193

Human   171 SPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLV 235
            |||:....||:.|||:||||||::|:..|...||..:...|...|..|..:.....||.::..|:
pombe   194 SPEIIRSSPYSAKSDVWALGCVIFEICMLTHPFEGRSYLELQRNICQGNLSCWDHHYSDDVFLLI 258

Human   236 LSLLSLEPAQRPPLSHIMAQPLC--IRALL 263
            ...|.:....||....::..|:.  ||:.|
pombe   259 RHCLEVNSDLRPTTYQLLRSPILSDIRSKL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NEK8NP_835464.1 STKc_Nek8 3..258 CDD:270859 95/279 (34%)
RCC1 276..657 CDD:332518
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..301
RCC1 1 312..350
RCC1 2 410..461
RCC1 3 462..513
RCC1 4 580..631
RCC1 5 632..684
fin1NP_593305.1 STKc_Nek2 3..281 CDD:270857 95/279 (34%)
S_TKc 4..281 CDD:214567 94/278 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000168
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R445
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.