DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR17 and AstC-R2

DIOPT Version :9

Sequence 1:NP_001154887.1 Gene:GPR17 / 2840 HGNCID:4471 Length:367 Species:Homo sapiens
Sequence 2:NP_001303398.1 Gene:AstC-R2 / 40019 FlyBaseID:FBgn0036789 Length:593 Species:Drosophila melanogaster


Alignment Length:295 Identity:86/295 - (29%)
Similarity:150/295 - (50%) Gaps:25/295 - (8%)


- Green bases have known domain annotations that are detailed below.


Human    66 YLLDFILALVGNTLALWLFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFGEI 130
            |.|..|:.|.||||.:::.:|..|..|..|:::::||:|| .|.|:....|:|.....:||||..
  Fly   152 YALVCIIGLFGNTLVIYVVMRFSKMQTVTNIYILNLAIAD-ECFLIGIPFLLYTMQVGNWPFGNY 215

Human   131 ACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHLACAFLWVVVAVAMAPLL 195
            .|:.......:..:.|..||..:||||::|:.||:.|.:.|.|..:.|..||.|:...:.|.|::
  Fly   216 MCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVI 280

Human   196 VSPQTVQ-TNHTVVCLQLYREKASHHA-----LVSLAVAFTFPFITTVTCYLLIIRSL-----RQ 249
            :...||| :|..|.|...:.:..:.|.     |.||.:.|..|....:..|.|:||.|     :.
  Fly   281 LFASTVQSSNGNVSCNIEWPDTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKH 345

Human   250 GLRVEKRLKTKAVRMIAIVLAIFLVCFVPYHVNRSVYVLHYRSHGASCATQRILA--LANRITSC 312
            ..:.:||...|..:::..|::.::.|::|:.:::...:   .|....||::..||  ||   ..|
  Fly   346 KSKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALI---SSAPQRCASRLELAVFLA---CGC 404

Human   313 LTSLNGALDPIMYFFVAEKFRHAL---CNLLCGKR 344
            |:..|.|::||:|.|:::.|:.:.   |.  |..|
  Fly   405 LSYSNSAMNPILYAFLSDNFKKSFMKACT--CAAR 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR17NP_001154887.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
7tm_1 76..325 CDD:278431 76/261 (29%)
AstC-R2NP_001303398.1 7tm_4 156..>372 CDD:304433 63/216 (29%)
7tm_1 162..417 CDD:278431 76/261 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X22
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.