DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRTG and Dscam3

DIOPT Version :10

Sequence 1:NP_776175.2 Gene:PRTG / 283659 HGNCID:26373 Length:1150 Species:Homo sapiens
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:1436 Identity:281/1436 - (19%)
Similarity:480/1436 - (33%) Gaps:429/1436 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    41 FVKEPQDVTVTRKDPVVLDCQAHGEVPIKVTWLKNGAKMSENKRIEVLS---NGSLYISEVEGRR 102
            :|:....:.....:.:::.|...|....::.|.|...:::.:...|:.|   .|.|.|..||..|
  Fly   541 YVRAIGPIKAVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGR 605

Human   103 GEQSDEGFYQCLAMNKYGAILSQKAHLALSTISAFEVQPISTEVHEGGVARFACKISS-HPPAVI 166
                |:|.|.|:..::.|....:...|.:::....|.......:.|||.|:..|.:|| ..|...
  Fly   606 ----DQGIYTCIVRSRAGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYF 666

Human   167 TWEFNRTTLPMTMDRITALPT---GVLQIYDVSQRDSGNYRCIAATVAHR-RKSMEASLTVIPAK 227
            :|:.:.:::|.:: :||....   .:|...|:|.|.||.|.|.|:..|.: ..:.|..:.|.|..
  Fly   667 SWKKDDSSIPSSL-QITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQVRVAPRW 730

Human   228 ESKSFHTPTIIAGPQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFNTRVLGNGNLMIS 292
            ..:          |.:....|..|:.:.|.|.|.|.|.|:|.:...|....|....:.|.:|:::
  Fly   731 RYE----------PMDTAIMLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRNHSLLLN 785

Human   293 DVRLQHAGVYVCRATT---PGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVCQAEGIP 354
            .......|.|:|:||.   .|.:. |:   .:.|..|..|.:...:::..|.......|.|:|..
  Fly   786 LATDNDEGYYMCQATNEIGAGLKK-TI---RINVNEPARFEQSARNISSRRNDPVTLDCHAKGDE 846

Human   355 SPKMSWLKNGRKIHSNGRIKMYN---------------SKLVINQIIPEDDAIYQCMAENSQGSI 404
            ...:.|.:|      ||||.:.|               |:|.|......|..:|:|:|||..|  
  Fly   847 PITIGWTQN------NGRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYG-- 903

Human   405 LSRARLTVVMS-EDRPSAPYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQ 468
              ||...:.:: ::||..|.::....:.|..:.|:|.||...:..|::|.|.|...:.|.:....
  Fly   904 --RAEQIIFLAVQERPDTPSHLEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKYLQSHGSL 966

Human   469 VVIGNDTTHYIID-----------------------DLEPASNYTFYIVAYMPMGASQMSDHVTQ 510
            ...|.|...::|:                       .|.||:.:...:.|...:..|..::.:..
  Fly   967 AAAGGDWNGHVINVSLPSTSISRSYDSDLRESAIVAGLTPATTFLIRMQAINEIERSAYTEAIVL 1031

Human   511 NTLEDVPLR-PPEISLTSRSPTDILISWLPIPAKYRRGQVVLY---------RLSFRLSTENSIQ 565
            .|.|:.|.. |..:.:.:...::::::|...|.:...|:::.|         .::|.....:|::
  Fly  1032 KTQEEAPTEAPSNVQVQTGGESELIVTWQIPPRESWNGELIGYTVNCSEEKQNINFISVVNSSLK 1096

Human   566 VLELPG-TTHEYLLEGLKPDSVYLVRITAATRVGLGESSVWTSHRTPKATSVKAPKSPELHLEPL 629
            ...:.| .|.:..|.||:..|.|.|.|.|....|.|..|......|.:.....||::       :
  Fly  1097 STIVSGWATTKATLRGLRKYSRYAVTIRAMNSFGSGPWSAAIFGTTAEGVPEAAPQN-------V 1154

Human   630 NCTTIS-----VRWQQDVED--TAAIQGYKLYYKEEGQQENGPIFLD---TKDLLYTLSGLDPRR 684
            |||.:|     :.|.:....  ...|||||:.|:....|.:.|..|:   |.:|...|..|....
  Fly  1155 NCTALSSQSLKISWLEPPLQFHGGIIQGYKILYRPIVHQIDFPAKLEIKRTSNLETYLHTLHKAS 1219

Human   685 KYHVRLLAYNNIDDGY-------QADQTVSTPGCVSVRDRMVPPPPPPHHLYAKANTSSSIFLHW 742
            .|.:|:|||....||.       |.|..|               |..|..:.|.|.|:.||.:.|
  Fly  1220 NYSIRVLAYTATGDGLASHPLFCQTDDDV---------------PDAPAAIKAAALTADSILISW 1269

Human   743 RRPAFTAAQIINYTIRCNPVGLQNASLVLYLQTSETHML------------VQGLEPNTKYEFAV 795
            ..|......|.:||:.....|.:.        .::|||:            .:.|..|..|||.|
  Fly  1270 LTPKNRNGIISHYTVYSREAGRKG--------QAKTHMVRVDENGYPVTFESRSLAENQMYEFWV 1326

Human   796 RLHVDQLSSPWSPVVYHSTLPEAPA------------------------GPPV------------ 824
            ...........:.|:..:|...|||                        |.|.            
  Fly  1327 SASTSVGEGEPTSVIAQATNTRAPARIASFGQVVRKAVGTGLVLECLAVGNPTPRARWLTRDRPV 1391

Human   825 ------------GVKVTLIEDDTA-------------------LVSWKPPDGPETVVTRYTILYA 858
                        .:|:..:|...:                   :::.|||..|: ::.:|....:
  Fly  1392 TFSPFYEVTNEGNLKIHRVEGSLSGNYTCTANNLFGSDEIQYQVIAMKPPSAPQ-IIVQYASADS 1455

Human   859 SRKAW------------------IAGE-W---QVLHREGAITMALLENLVAGNVYIVKISASNEV 901
            .|.:|                  .||| |   ::|....|.|   :..|..||.||:|:||.|.|
  Fly  1456 IRVSWDAPDDGGAPLQGYTISYHTAGESWSITELLPENNAFT---ISGLKCGNQYIIKMSAHNMV 1517

Human   902 GEGPFSNSVEL----------------------------------------------------AV 914
            |.|..|..:.:                                                    .|
  Fly  1518 GSGVASEEINVWTKGKASQAPNANELIATNATCVNLKLSSWQNGGCSIHHFSIEHRPLGDIRWTV 1582

Human   915 LPKETSESNQRPKRL---DSADAKVY-------------SGYYHLDQKSMTGIAV---------- 953
            :..:.|.:.:..:.|   |...||.|             :.:||....::.||.:          
  Fly  1583 VTSDISNAEENRENLIFCDFLPAKWYQLRISATNDAGKTTEHYHFSTTNIDGITIPPPSVFPSEN 1647

Human   954 ------------------GVGIALTCILICVLILIYRSKARKSSASKTAQN-GTQQLP------- 992
                              ...|.:..|.:.::.:....|.|::.....|:. .::.||       
  Fly  1648 DLMNNLINSTNPTSGDWFATLIVVVIITVSIITIALTIKHRRTLCGPIAEGYESRTLPGDYKEDH 1712

Human   993 --RTSASLASGNEVGKNLEGAVGNEESLMPMIMPNSFIDAKG----------------------- 1032
              |.:..:.|.:.| |.::  .|| ||.|..|.|.:.....|                       
  Fly  1713 ENRRNQQVYSASPV-KTVD--KGN-ESEMYEISPYATFSVNGGRTGAPAKTPTRAVAAQTPLDYT 1773

Human  1033 ----------GTDLIINSYGPIIKNN------SKKKWFFFQDSKKIQVEQPQRRFTPAVCFYQPG 1081
                      |.:|...:| |::.::      ||..|            ..||.:          
  Fly  1774 MQFKTFGHPEGENLNATAY-PLLPSSGFGHVKSKSSW------------HKQRYY---------- 1815

Human  1082 TTVLISDEDSPSSPGQTTSFSRPFGVAADTEHSANSEGSHETGDSGRFS-----HESNDEIHLSS 1141
                 :.||.     .|.|.|......:...||..|.|......|...|     .||:..|..|:
  Fly  1816 -----NTEDE-----STLSKSMTIVAGSQAGHSKKSNGGRSAKSSAACSGVVAGSESDTSISPST 1870

Human  1142 VISTTP 1147
            ..|..|
  Fly  1871 EFSNMP 1876

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRTGNP_776175.2 Ig 38..130 CDD:472250 18/91 (20%)
Ig strand B 56..60 CDD:409353 0/3 (0%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 91..95 CDD:409353 2/3 (67%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
Ig strand G 124..127 CDD:409353 0/2 (0%)
IG_like 141..223 CDD:214653 23/86 (27%)
Ig strand B 152..156 CDD:409353 1/3 (33%)
Ig strand C 165..169 CDD:409353 0/3 (0%)
Ig strand E 188..192 CDD:409353 1/3 (33%)
Ig strand F 202..207 CDD:409353 2/4 (50%)
Ig_3 235..307 CDD:464046 17/71 (24%)
I-set 327..412 CDD:400151 24/99 (24%)
Ig strand B 345..348 CDD:143205 0/2 (0%)
Ig strand C 357..361 CDD:143205 0/3 (0%)
Ig strand E 378..382 CDD:143205 2/3 (67%)
Ig strand F 392..397 CDD:143205 2/4 (50%)
Ig strand G 405..408 CDD:143205 0/2 (0%)
FN3 419..512 CDD:238020 20/115 (17%)
FN3 517..610 CDD:238020 21/103 (20%)
fn3 624..699 CDD:394996 23/84 (27%)
FN3 <728..>936 CDD:442628 61/363 (17%)
FN3 821..911 CDD:238020 31/154 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 981..1002 5/30 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1086..1150 17/67 (25%)
Dscam3NP_996226.2 Ig 38..135 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 113..118 CDD:409353
Ig strand G 126..130 CDD:409353
Ig 246..337 CDD:472250
Ig strand B 264..268 CDD:409353
Ig strand C 277..281 CDD:409353
Ig strand E 303..307 CDD:409353
Ig strand F 317..322 CDD:409353
Ig strand G 330..333 CDD:409353
Ig 341..434 CDD:472250
Ig strand B 358..362 CDD:409353
Ig strand C 371..375 CDD:409353
Ig strand E 400..404 CDD:409353
Ig strand F 414..419 CDD:409353
Ig strand G 427..430 CDD:409353
IgI_4_Dscam 439..536 CDD:409548
Ig strand A' 447..451 CDD:409548
Ig strand B 454..463 CDD:409548
Ig strand C 468..474 CDD:409548
Ig strand C' 476..479 CDD:409548
Ig strand D 487..495 CDD:409548
Ig strand E 499..508 CDD:409548
Ig strand F 515..523 CDD:409548
Ig strand G 526..536 CDD:409548
Ig 539..630 CDD:472250 19/92 (21%)
Ig strand B 556..560 CDD:409353 0/3 (0%)
Ig strand C 569..573 CDD:409353 0/3 (0%)
Ig strand E 594..598 CDD:409353 2/3 (67%)
Ig strand F 609..614 CDD:409353 2/4 (50%)
Ig strand G 623..626 CDD:409353 0/2 (0%)
Ig 633..724 CDD:472250 24/91 (26%)
Ig strand B 651..655 CDD:409353 1/3 (33%)
Ig strand C 665..669 CDD:409353 0/3 (0%)
Ig strand E 690..694 CDD:409353 1/3 (33%)
Ig strand F 704..709 CDD:409353 2/4 (50%)
Ig strand G 717..720 CDD:409353 0/2 (0%)
Ig 728..815 CDD:472250 22/100 (22%)
Ig strand B 745..749 CDD:409353 0/3 (0%)
Ig strand C 758..762 CDD:409353 1/3 (33%)
Ig strand E 780..784 CDD:409353 1/3 (33%)
Ig strand F 794..799 CDD:409353 2/4 (50%)
Ig strand G 808..811 CDD:409353 0/3 (0%)
Ig 820..913 CDD:472250 24/102 (24%)
Ig strand C 849..853 CDD:409353 0/3 (0%)
Ig strand E 879..883 CDD:409353 2/3 (67%)
Ig strand F 893..898 CDD:409353 2/4 (50%)
Ig strand G 906..909 CDD:409353 0/2 (0%)
FN3 <940..1417 CDD:442628 99/506 (20%)
Ig 1355..1430 CDD:472250 4/74 (5%)
Ig strand B 1368..1372 CDD:409353 0/3 (0%)
Ig strand C 1381..1385 CDD:409353 0/3 (0%)
Ig strand E 1403..1407 CDD:409353 0/3 (0%)
Ig strand F 1417..1422 CDD:409353 0/4 (0%)
Ig strand G 1430..1433 CDD:409353 0/2 (0%)
FN3 1441..1530 CDD:238020 25/92 (27%)
FN3 1542..1620 CDD:238020 7/77 (9%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.