DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSSK4 and Sik3

DIOPT Version :10

Sequence 1:NP_001171668.1 Gene:TSSK4 / 283629 HGNCID:19825 Length:338 Species:Homo sapiens
Sequence 2:NP_611361.4 Gene:Sik3 / 37152 FlyBaseID:FBgn0262103 Length:1471 Species:Drosophila melanogaster


Alignment Length:101 Identity:26/101 - (25%)
Similarity:41/101 - (40%) Gaps:16/101 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   140 NGSLWLSSPLEQEDSDDEEALRIWKVTEGSYSCL--AHSPLGVVASQVAVVK----------LAT 192
            |.|:.|......|..|.::.|.:|:.| |.:..:  |...|....|.|.:::          |..
  Fly    91 NLSMELIGSWNVEVGDLDQCLHLWRYT-GGFEMVDQAKRELSSDKSYVQLMQERGTFLRSRHLQY 154

Human   193 LEDFSLHPESQIVEENGTARFECHTKGL-PAPIITW 227
            |..||..|:.|:.|  |...:|..:..| |..:|.|
  Fly   155 LLAFSYWPQLQLRE--GKNIYEIRSYRLKPGTMIEW 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSSK4NP_001171668.1 STKc_TSSK4-like 24..303 CDD:271064 26/101 (26%)
Sik3NP_611361.4 Protein Kinases, catalytic domain 40..292 CDD:473864 26/101 (26%)
UBA_SIK 335..380 CDD:270523
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.