DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KSR2 and DUN1

DIOPT Version :9

Sequence 1:NP_775869.4 Gene:KSR2 / 283455 HGNCID:18610 Length:950 Species:Homo sapiens
Sequence 2:NP_010182.1 Gene:DUN1 / 851457 SGDID:S000002259 Length:513 Species:Saccharomyces cerevisiae


Alignment Length:300 Identity:63/300 - (21%)
Similarity:127/300 - (42%) Gaps:60/300 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   616 SENEEVHDEAEESEDDFEEMNLSLLSARSFPRKASQTSIFLQEWDIP---FEQLEIGELIGKGRF 677
            :::|:|..|:...::|.|......:||.|.....:..:|.......|   |::..:|:.:|.|.:
Yeast   147 NDDEKVSSESRSYKNDDEVFKKPQISATSSQNATTSAAIRKLNKTRPVSFFDKYLLGKELGAGHY 211

Human   678 GQVYHG---RWHGEVAIRLIDIERDNEDQL--KAFKREVMAYRQTRHENVVLFMGACMSP----- 732
            ..|...   :...:||:::...:: |:||.  |.|:.|.....:.:|.|:|..:.:.:.|     
Yeast   212 ALVKEAKNKKTGQQVAVKIFHAQQ-NDDQKKNKQFREETNILMRVQHPNIVNLLDSFVEPISKSQ 275

Human   733 -PHLAIITSLCKGRTLYSVVRDAKIVLDVNKTRQIAQEIVKGMGYLHAKGILHKDLKSKNVF--- 793
             ....::..:..|.....:||  |..|..::::.:.::::.|:.|||.:.|:|:|:|.:|:.   
Yeast   276 IQKYLVLEKIDDGELFERIVR--KTCLRQDESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNI 338

Human   794 -------------YDNG----KVVITDFGLFSISGVLQAGRREDKLRIQNGWLC----HLAPEII 837
                         :|..    :|.|.||||...:|.:|.          ...||    ::|||::
Yeast   339 TRRENPSQVQLGPWDEDEIDIQVKIADFGLAKFTGEMQF----------TNTLCGTPSYVAPEVL 393

Human   838 RQLSPDTEEDKLPFSKHSDVFALGTIWYELHAREWPFKTQ 877
                     .|..::...|:::.|.|.|.......||..|
Yeast   394 ---------TKKGYTSKVDLWSAGVILYVCLCGFPPFSDQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KSR2NP_775869.4 KSR1-SAM 24..152 CDD:404435
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..296
C1 408..464 CDD:412127
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..556
PK_KSR2 665..934 CDD:271055 51/247 (21%)
DUN1NP_010182.1 FHA 36..136 CDD:238017
STKc_CAMK 199..479 CDD:270687 51/247 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.