DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC22A24 and CG33233

DIOPT Version :9

Sequence 1:NP_001129978.2 Gene:SLC22A24 / 283238 HGNCID:28542 Length:552 Species:Homo sapiens
Sequence 2:NP_995978.2 Gene:CG33233 / 2769005 FlyBaseID:FBgn0053233 Length:489 Species:Drosophila melanogaster


Alignment Length:474 Identity:92/474 - (19%)
Similarity:174/474 - (36%) Gaps:126/474 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   139 CE---SQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQLAISNTCAAFAPTFLVYC 200
            ||   |...|:::.:..:.|.:..||..|.|:||.|||.:.:|..:.....:..:|..|......
  Fly    49 CEFDTSPKEKTLLANSLLGGMVASGLFIGFLADRYGRKFVIRLALVGALSFSVISALMPDLYSLS 113

Human   201 ILRFLAG--FSTMTILGNTFI---LSLEWTLPRSRSMTIMVLLCSYSVGQMLLG----------- 249
            ::|.:.|  .|.:..|...|:   .:::|       ..|.|.:||.|.|..|:.           
  Fly   114 VIRIIVGTFLSAVASLQVGFLGEFHAIKW-------RPITVAICSQSQGLALIYCPLVAMAILPN 171

Human   250 ------GLAFAIQDWHILQLTVSTPIIVLFLSSWKMVESARWLIINNQLDEGLKELRRVAHINGK 308
                  ..::.::.|..|.:....|..:..:....:.|:..:|:..|:.|:.|..|:.:..:|.|
  Fly   172 NFNVDLSSSYNLRVWRFLMMFFMIPGWLALVGICLVPETPHFLMSVNRPDKALLALKWICRMNRK 236

Human   309 KNTEETLTTELVRS----------TMKKELDAVRIKTSIFSLFRAPKLRMRVFGLCFVRFAITVP 363
            |..:..:|....:|          |:..|...:..|..:|..|....|   :||:.|....:.: 
  Fly   237 KWEDVDITLSEEKSSTNDQEGFWKTVWYEYKLLFSKPHVFKFFICLFL---IFGIFFTSIGLGI- 297

Human   364 FYGLILNLQHLGSNVSLFQILCGAV----TFTARCVSLLTLNH------------------MGRR 406
            ::.:|.|:.:.|||     .||..|    ||         :||                  |...
  Fly   298 WFPVIRNMDNSGSN-----RLCDLVNNNPTF---------INHEADDTNGTDSESPKCNDEMTNL 348

Human   407 ISQILFTFP-VGLFILVNTFL----------------------------PQEMQILRVVLATLGI 442
            |..:.:.|. :|.|||.:..:                            |..:.|..|::..|. 
  Fly   349 IDPVYYGFTYIGCFILASVLVHWMTRKYVIALHILISMILGISLNIMKQPTVVLIFFVLMMVLP- 412

Human   443 GSVSAASNSASVHHNELVPTILRS----TVAGINAVSGRTGAALAPLLMTLMAYSPHLPWISYGV 503
            |.:...:.|..|   :.:|..||.    .|..:....|..|:.:..|.:.:...      :::.:
  Fly   413 GVLIPLATSVLV---DCLPVNLRGKALCMVRSLARFGGVLGSTMIGLFIRVTCD------VTFNI 468

Human   504 FPI-LAVPVILLLPETRDL 521
            |.: ||:.|:|.:.:.:|:
  Fly   469 FNLCLAICVVLAVFQPKDI 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC22A24NP_001129978.2 MFS_OAT 109..516 CDD:340932 91/467 (19%)
CG33233NP_995978.2 MFS_1 22..451 CDD:284993 84/430 (20%)
MFS 23..>208 CDD:119392 33/165 (20%)
MFS 354..>482 CDD:304372 24/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.