DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4C13 and srx-10

DIOPT Version :9

Sequence 1:NP_001001955.2 Gene:OR4C13 / 283092 HGNCID:15169 Length:309 Species:Homo sapiens
Sequence 2:NP_506459.3 Gene:srx-10 / 187761 WormBaseID:WBGene00005901 Length:315 Species:Caenorhabditis elegans


Alignment Length:259 Identity:56/259 - (21%)
Similarity:100/259 - (38%) Gaps:54/259 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    67 IDACYSSVNTPKLITDS--LYENKTILFNGCMTQVFGEHFFRGVEVILLTVMAYDH--YVAICKP 127
            ::.||.:   |.:|:||  |.::...|....||::  .||.....:.::.|||.:.  .|.:.||
 Worm    57 VNLCYFA---PSIISDSYILADSPEKLGPMLMTRI--SHFSWYNTIFVMIVMALNRMTLVVLNKP 116

Human   128 LHYTTVMKQHVCSLLVGVSWVGGFLHATIQILFICQLPFCGPNVIDH--FMCDLYTLINL----- 185
            ..:|   ||.|.:... :|.:..|......:..|   |.| ..::||  :....|...|:     
 Worm   117 NIFT---KQRVLTYFF-ISSILSFSKVVFDVFLI---PCC-LVLMDHKKYGWTYYNPKNIKNWGE 173

Human   186 ACTNTHTLGLFIAANSGFICLLNCLLLLVSCVVILYSLKTHSLEARH--------------EALS 236
            .......:|:|.|.       |.|.:::...:.|..:....|::::|              .||.
 Worm   174 LIDTIMEVGIFTAT-------LLCYVIIFIKIRISNNSVEQSIDSKHFQKLRARERSVAVQFALV 231

Human   237 TCVSHITVVILSFIPCIFVYMRPPATL--PIDKAVAVFYTMITSMLNPLIYTLRNAQMKNAIRK 298
            :..|.|:......:|.||..:...:.:  ||..||       ....|..||...|.::|:.:.|
 Worm   232 SIFSIISFASFKVVPMIFGKLNTESNIISPICFAV-------HCCANGCIYMFMNEEVKDELLK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4C13NP_001001955.2 7tm_4 29..303 CDD:304433 56/259 (22%)
7tm_1 39..285 CDD:278431 51/244 (21%)
srx-10NP_506459.3 7tm_GPCRs 11..248 CDD:391938 44/210 (21%)
TM helix 4 123..148 CDD:341315 4/28 (14%)
TM helix 5 173..193 CDD:341315 5/26 (19%)
TM helix 6 219..246 CDD:341315 4/26 (15%)
TM helix 7 257..279 CDD:341315 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.