DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4C13 and LOC105948131

DIOPT Version :9

Sequence 1:NP_001001955.2 Gene:OR4C13 / 283092 HGNCID:15169 Length:309 Species:Homo sapiens
Sequence 2:XP_012824346.3 Gene:LOC105948131 / 105948131 -ID:- Length:264 Species:Xenopus tropicalis


Alignment Length:265 Identity:100/265 - (37%)
Similarity:154/265 - (58%) Gaps:19/265 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    44 VVTITASPSLRSPMYFFLAYLSFIDACYSSVNTPKLITDSLYENKTILFNGCMTQVFGEHFFRGV 108
            :..:..|..|::||||||..||.||...||...|.|:.:::..:|:|...||..|::   |..|:
 Frog     1 MTVVGTSVQLQTPMYFFLCNLSVIDIGLSSTIVPTLLINTVARDKSISLLGCGVQMY---FHLGL 62

Human   109 ---EVILLTVMAYDHYVAICKPLHYTTVMKQHVCSLLVGVSWVGGFLHATIQILFICQLPFCGPN 170
               |.|.|:|:|||.|.|||:||||..:|.:.||..|...||....:::.|.::...|||||..|
 Frog    63 GCTECITLSVIAYDRYAAICQPLHYYQIMSKTVCICLASGSWAVSLINSAIHVVLTFQLPFCRSN 127

Human   171 VIDHFMCDLYTLINLACTN--THTLGLFIAANSGFICLLNCLLLLVSCV-VILYSLKTHSLEARH 232
            .|:||.|::...:.::|.:  .:.|.::|||:  .|...:.||.|:|.. ::|..||..|.|.|.
 Frog   128 HINHFFCEMPPFLYISCGDPWLNELVMYIAAS--IIGAGSFLLTLISYFSIVLTILKMCSTEGRI 190

Human   233 EALSTCVSHITVVILSFIPCIFVYMRP-----PATLPIDKAVAVFYTMITSMLNPLIYTLRNAQM 292
            :|.|||.||:||..|.:...:|:|:.|     |.|   .|.|::.||::|.||||:||::||..:
 Frog   191 KAFSTCASHLTVFFLYYGTILFMYLHPHSDNYPET---SKTVSIIYTVVTPMLNPIIYSIRNGDV 252

Human   293 KNAIR 297
            |.:|:
 Frog   253 KRSIK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4C13NP_001001955.2 7tm_4 29..303 CDD:304433 100/265 (38%)
7tm_1 39..285 CDD:278431 94/251 (37%)
LOC105948131XP_012824346.3 7tmA_OR 1..249 CDD:320092 96/255 (38%)
TM helix 2 15..37 CDD:320092 11/21 (52%)
TM helix 3 53..75 CDD:320092 7/24 (29%)
TM helix 4 98..114 CDD:320092 3/15 (20%)
TM helix 5 151..174 CDD:320092 9/24 (38%)
TM helix 6 193..215 CDD:320092 9/21 (43%)
TM helix 7 224..249 CDD:320092 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.