DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OR4C13 and drd1

DIOPT Version :9

Sequence 1:NP_001001955.2 Gene:OR4C13 / 283092 HGNCID:15169 Length:309 Species:Homo sapiens
Sequence 2:XP_017947694.2 Gene:drd1 / 100485463 XenbaseID:XB-GENE-6035431 Length:451 Species:Xenopus tropicalis


Alignment Length:369 Identity:78/369 - (21%)
Similarity:132/369 - (35%) Gaps:89/369 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     3 NRNNVTEFILLGLTENPKMQKIIFVVF-SVIYINAMIGNVLIVVTITASPSLRSPM-YFFLAYLS 65
            |..::.|.:|  |.|.....:::...| ||:.::.::||.|:...:.....|||.: .||:..|:
 Frog     4 NITSMDEDVL--LAERDSSFRVLTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLA 66

Human    66 FIDACYSSVNTP-KLITD-------SLYENKTILFN-GCMTQVFGEHFFRGVEVILLTVMAYDHY 121
            ..|...:.:..| |.:.:       ..:.|..:.|: .|.|          ..::.|.|::.|.|
 Frog    67 VSDLLVAVLVMPWKAVAEIAGFWPFGTFCNIWVAFDIMCST----------ASILNLCVISVDRY 121

Human   122 VAICKPLHYTTVMKQHVCSLLVGVSWVGGFLHATIQILFI-CQLPFCGPNVIDHFMCDLYTLINL 185
            .||..|..|...|...|..:::.|:|.     .:|.|.|| .||.:........|..:: ||...
 Frog   122 WAISSPFRYERKMTPKVAFIMISVAWT-----LSILISFIPVQLNWHKAKTTSFFDLNI-TLHGR 180

Human   186 ACTN-THTLGLFIAANSGFICLLNCLLLLVSCVVILY---------------------------- 221
            ...| ..:|....|.:|..|.....:.:::.....:|                            
 Frog   181 TMDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAAKQIRRISALERAAVHAKNCQNSTG 245

Human   222 ------------SLKTHSLEARHEALSTCVSHITVVILSFIP-----CIFVYMRPPATLPIDKA- 268
                        |||| |.:...:.|.|....:.|.:..::|     ||..:..|..|....:. 
 Frog   246 NRNSLDCQQPESSLKT-SFKRETKVLKTLSVIMGVFVCCWLPFFILNCIVPFCDPSLTTSGTEPF 309

Human   269 --------VAVFYTMITSMLNPLIYTLRNAQMKNAIRKL--CSR 302
                    |.|::....|.|||:||.. ||..:.|...|  |.|
 Frog   310 CISSTTFDVFVWFGWANSSLNPIIYAF-NADFRKAFSNLLGCYR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OR4C13NP_001001955.2 7tm_4 29..303 CDD:304433 73/343 (21%)
7tm_1 39..285 CDD:278431 62/311 (20%)
drd1XP_017947694.2 7tmA_D1A_dopamine_R 22..344 CDD:320443 69/339 (20%)
TM helix 1 25..49 CDD:320443 6/23 (26%)
TM helix 2 59..81 CDD:320443 5/21 (24%)
TM helix 3 96..118 CDD:320443 6/31 (19%)
TM helix 4 141..157 CDD:320443 5/20 (25%)
TM helix 5 191..214 CDD:320443 3/22 (14%)
TM helix 6 270..292 CDD:320443 4/21 (19%)
TM helix 7 313..338 CDD:320443 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.