Sequence 1: | NP_001273028.1 | Gene: | GPR6 / 2830 | HGNCID: | 4515 | Length: | 377 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001137708.2 | Gene: | 5-HT1B / 37191 | FlyBaseID: | FBgn0263116 | Length: | 629 | Species: | Drosophila melanogaster |
Alignment Length: | 539 | Identity: | 100/539 - (18%) |
---|---|---|---|
Similarity: | 147/539 - (27%) | Gaps: | 256/539 - (47%) |
- Green bases have known domain annotations that are detailed below.
Human 86 AVNPWDVLLCVSGTVIAG--------ENALVVALIASTPALRTPMFVLVGSLATADLLAGC---- 138
Human 139 -GLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHL 202
Human 203 LLAATWTVSLGLGLLPVLGW------------NCLAER-------AAC----------------- 231
Human 232 --------------------------SVVRPLARSH----------------------------- 241
Human 242 --------------------------VALLSAAFFMVFGIML-----------------HLYVRI 263
Human 264 CQVV-----WR--HAHQI---------ALQQH----------------------CL--------- 281
Human 282 ------------------------------------------APPH--LA---------ATRKGV 293
Human 294 GTLAVVLGTFGASWLPFAIYCVVGS-HEDPAVYTYAT---LLPATYNSMINPIIYAFRNQEIQRA 354
Human 355 LWLLLCGCFQSKVPFRSRS 373 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GPR6 | NP_001273028.1 | 7tmA_GPR6 | 88..355 | CDD:320628 | 91/517 (18%) |
TM helix 1 | 89..115 | CDD:320628 | 7/33 (21%) | ||
TM helix 2 | 122..147 | CDD:320628 | 10/29 (34%) | ||
TM helix 3 | 156..186 | CDD:320628 | 10/29 (34%) | ||
TM helix 4 | 198..218 | CDD:320628 | 5/19 (26%) | ||
TM helix 5 | 237..266 | CDD:320628 | 7/100 (7%) | ||
TM helix 6 | 287..317 | CDD:320628 | 12/38 (32%) | ||
TM helix 7 | 323..348 | CDD:320628 | 8/27 (30%) | ||
5-HT1B | NP_001137708.2 | 7tm_1 | 107..>288 | CDD:278431 | 41/182 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |