DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK32C and S6k

DIOPT Version :9

Sequence 1:XP_011537990.1 Gene:STK32C / 282974 HGNCID:21332 Length:504 Species:Homo sapiens
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:460 Identity:130/460 - (28%)
Similarity:208/460 - (45%) Gaps:67/460 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    63 LSPNLASGL--AARGTQT-----QSVLFGEVRL-PLDGGVRGARKRMNFDHFQILRAIGKGSFGK 119
            |.|.|...|  ...|.:|     ::|..|:::| |.|              |::.:.:|||.:||
  Fly    40 LEPELCINLHQDTEGQETIQLCEENVNPGKIKLGPKD--------------FELKKVLGKGGYGK 90

Human   120 PCALQVCIVQKRDTEKMYAMKYMNKQQCI-ERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEED 183
              ..||.....||..|.:|||.:.|...: .:.:..:...|..||:.::|.|:|.|.|:||.:..
  Fly    91 --VFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFIVELVYAFQTDGK 153

Human   184 MFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHA 248
            ::::::.|.||:|..||::...|.|||...|:.|:.|||.:|....||:||:||:|||||.:||.
  Fly   154 LYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLKPENILLDAQGHV 218

Human   249 HLTDFNIA-TIIKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRP 312
            .||||.:. ..|::|.......||..||||||...     :|:...|||||:|.:.:::|.|..|
  Fly   219 KLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTR-----SGHGKAVDWWSLGALMFDMLTGVPP 278

Human   313 YDIHS-SNAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQD----VQAAPALA 372
            :...: ...:|::::....:.....|    |...|:|:|:......||.|..:    ||..|...
  Fly   279 FTAENRKKTIETILKAKLNLPAYLTP----EARDLVRRLMKRQEPQRLGSGPEDAAAVQIHPFFK 339

Human   373 GVLWDHLSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEN 437
            .|.||.:..:|:||...|               ::.....:.:...|..:....|:..|::.||:
  Fly   340 HVNWDDVLARRLEPPIKP---------------LLRSEDDVSQFDTRFTRQIPVDSPDDTTLSES 389

Human   438 DYLQDCLDAIQQDFVIFNREKLKRSQDLPR-EPLPAPESRDAAEPVEDEAERSALPMC--GPICP 499
            ..|      |.|.|.......|   :|:.| ..:||...|.....:.|.:.|...|..  |...|
  Fly   390 ANL------IFQGFTYVAPSIL---EDMHRANRMPARSPRRTPRQLPDSSFRLQFPSANVGANAP 445

Human   500 SAGSG 504
            .|..|
  Fly   446 LAMHG 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK32CXP_011537990.1 STKc_Yank1 105..371 CDD:270730 90/272 (33%)
S_TKc 106..366 CDD:214567 87/266 (33%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 106/366 (29%)
STKc_p70S6K 81..402 CDD:270736 105/352 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.