DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POC1B and DGR2

DIOPT Version :9

Sequence 1:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens
Sequence 2:NP_012801.1 Gene:DGR2 / 853738 SGDID:S000001604 Length:852 Species:Saccharomyces cerevisiae


Alignment Length:595 Identity:117/595 - (19%)
Similarity:193/595 - (32%) Gaps:191/595 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    18 KAAITSLDLSPNGKQLATASWDTFLMLWNF--KPHARAYRYVGHKDVVTS-----------VQFS 69
            |.:|.....|.:||.:.....|..|.||..  .|..|:......|.|..|           ...|
Yeast   173 KNSICCCTFSHDGKYMVIGCKDGSLHLWKVINSPVKRSEMGRSEKSVSASRANSLKIQRHLASIS 237

Human    70 PHGNLLASASRDRTVRLWIPDKR----------GKFSEFKAHTAPVRSVDFSADGQFLATASEDK 124
            .|...::|.....:.:...|.|:          ..|..|..|...:...::|.:| ||.|||.||
Yeast   238 SHNGSISSNDLKPSDQFEGPSKQLHLYAPVFYSDVFRVFMEHALDILDANWSKNG-FLITASMDK 301

Human   125 SIKVWSMYRQRFLYSL--YRHTHWVRCAKFSP-DGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSV 186
            :.|:|...|:   |||  :.|..:|..|.|.| |.|.|::...|...::|...:.: |:...|..
Yeast   302 TAKLWHPERK---YSLKTFVHPDFVTSAIFFPNDDRFIITGCLDHRCRLWSILDNE-VSYAFDCK 362

Human   187 GFANFVDFNPSGTCIASAGSDQTVKVWDVRVNKLLQH-------YQV---HSGGVNCISFHPSGN 241
            .....:..:|.|      |....:..::..:..||.|       :.|   .:.|....|||||..
Yeast   363 DLITSLTLSPPG------GEYTIIGTFNGYIYVLLTHGLKFVSSFHVSDKSTQGTTKNSFHPSSE 421

Human   242 Y------------------------LITASSDGTLKILDLLEGRLIYTLQG-------HTGPVFT 275
            |                        ||..::|..::|.||.|.:.:...:|       |.|....
Yeast   422 YGKVQHGPRITGLQCFFSKVDKNLRLIVTTNDSKIQIFDLNEKKPLELFKGFQSGSSRHRGQFLM 486

Human   276 VSFSKGGELFASGGADTQVLLWR-TNFD---ELHC---------------KGLTK---------- 311
            :   |...:..:|..|.....|: .:|:   |::|               |||.:          
Yeast   487 M---KNEPVVFTGSDDHWFYTWKMQSFNLSAEMNCTAPHRKKRLSGSMSLKGLLRIVSNKSTNDE 548

Human   312 -----------------------------RNLKRLHFDSPPHLLDIYPRTPHPHEEKVETVEINP 347
                                         :.:|..|:.|           .|.|...|....|.|
Yeast   549 CLTETSNQSSSHTFTNSSKNVLQTQTVGSQAIKNNHYIS-----------FHAHNSPVTCASIAP 602

Human   348 KLEVIDLQISTPPVMDILSFDSTTTTETSGRTLPDKGEEACGYFLNPSLMSPECLPTTTKKKTED 412
            .:.:.:|.:|...:.::.|    ...:..|:.. .:.:|.|.       ..|....|.|...:.:
Yeast   603 DVAIKNLSLSNDLIFELTS----QYFKEMGQNY-SESKETCD-------NKPNHPVTETGGFSSN 655

Human   413 MSD---------LPCESQRSIPLAVTDALEHIMEQL-------NVL----------TQTVSILEQ 451
            :|:         :..:||..|.:..||.|..|.:::       |:.          ....||||.
Yeast   656 LSNVVNNVGTILITTDSQGLIRVFRTDILPEIRKKIIEKFHEYNLFHLEAAGKINNHNNDSILEN 720

Human   452 RL---TLTED 458
            |:   :.|||
Yeast   721 RMDERSSTED 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POC1BNP_758440.1 WD40 10..298 CDD:238121 76/346 (22%)
WD 1 16..55 11/38 (29%)
WD40 repeat 21..58 CDD:293791 10/38 (26%)
WD 2 58..99 9/61 (15%)
WD40 repeat 63..100 CDD:293791 8/57 (14%)
WD 3 101..139 13/37 (35%)
WD40 repeat 106..142 CDD:293791 15/37 (41%)
WD 4 142..181 11/39 (28%)
WD40 repeat 147..182 CDD:293791 10/35 (29%)
WD 5 183..223 6/39 (15%)
WD40 repeat 190..225 CDD:293791 6/41 (15%)
WD 6 226..265 15/65 (23%)
WD40 repeat 231..267 CDD:293791 13/59 (22%)
WD 7 268..307 10/64 (16%)
WD40 repeat 273..299 CDD:293791 4/26 (15%)
DGR2NP_012801.1 WD40 173..506 CDD:421866 76/346 (22%)
WD40 repeat 176..238 CDD:293791 13/61 (21%)
WD40 repeat 244..278 CDD:293791 5/33 (15%)
WD40 repeat 283..317 CDD:293791 15/37 (41%)
WD40 repeat 324..360 CDD:293791 9/36 (25%)
WD40 repeat 365..414 CDD:293791 8/54 (15%)
WD40 repeat 422..476 CDD:293791 9/53 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.