DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POC1B and ARC40

DIOPT Version :9

Sequence 1:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens
Sequence 2:NP_009793.1 Gene:ARC40 / 852536 SGDID:S000000438 Length:384 Species:Saccharomyces cerevisiae


Alignment Length:453 Identity:97/453 - (21%)
Similarity:154/453 - (33%) Gaps:158/453 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    77 SASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQR------ 135
            |.|:|::|          .:.:|...||:.|..||.|...||...|...:    :||..      
Yeast     4 SNSKDKSV----------VAVYKLVKAPIYSHCFSQDKSILAVTCETDCL----VYRVSNNTPPV 54

Human   136 FLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIW----DTTNKQC-----VNNFSDSVGFANF 191
            ...:|..|...:.....|..|| ||:||:|:...:|    |.|.|..     :|..:.||.:|  
Yeast    55 LFATLKDHDKTITAVDISIHGR-IVTCSQDRNAYVWEPLSDGTYKPTLVLLRINRAATSVTWA-- 116

Human   192 VDFNPSGTCIASAGSDQTVKV--------WDV--RVNKLLQHYQVHSGGVNCISFHPSGNYLITA 246
                |:|...|...|.:.:.|        |.|  .:.|.::      ..:||:|:|.:|..|...
Yeast   117 ----PNGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIK------STINCLSWHANGVLLAAG 171

Human   247 SSDGTLKI-------LDLLEGRLIYTLQGHTGPVFTVSFSKGGELFASG--------GADTQVLL 296
            .:||.:::       ||..|               :|:.|..|:.|..|        |:....:.
Yeast   172 GTDGFMRVFSGFIKGLDSKE---------------SVAGSPWGQKFPFGCLIREWYQGSYIHDVE 221

Human   297 WRTNFDELHCKGLTKRNLKRLHFDSPPHLLDIYPRTPHPHEEKVETVEINPKLEVIDLQISTPPV 361
            ||:..                                    |::..|..:..|.|:|.|   .||
Yeast   222 WRSQM------------------------------------ERIAYVAHDGTLNVVDYQ---SPV 247

Human   362 MDILSFDSTTTTETSGRTLPDKG-------EEAC-GYFLNPSLMSPECLPTTTKKKTEDMSDLPC 418
            ..:          .:...||.:.       |..| ||..:|.|.| |........|..|.||   
Yeast   248 QSV----------NAPEGLPYRSLVWINDHEIVCGGYSCHPVLFS-EASEGWKFAKNLDKSD--- 298

Human   419 ESQRSIPLAV---TDALEHIMEQLNVLTQTVSILEQRLTLTEDKLKDCLENQQKLFSAVQQKS 478
             :.:|..|..   ||.|....::    :.|..|...|      |.|: |:.:.|:.:.||:.:
Yeast   299 -NNKSSALTASGNTDELSGNNDE----SSTFGISALR------KFKE-LDLKGKVSTDVQESA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POC1BNP_758440.1 WD40 10..298 CDD:238121 59/260 (23%)
WD 1 16..55
WD40 repeat 21..58 CDD:293791
WD 2 58..99 4/21 (19%)
WD40 repeat 63..100 CDD:293791 4/22 (18%)
WD 3 101..139 11/43 (26%)
WD40 repeat 106..142 CDD:293791 10/41 (24%)
WD 4 142..181 13/47 (28%)
WD40 repeat 147..182 CDD:293791 13/43 (30%)
WD 5 183..223 11/49 (22%)
WD40 repeat 190..225 CDD:293791 8/44 (18%)
WD 6 226..265 11/45 (24%)
WD40 repeat 231..267 CDD:293791 11/42 (26%)
WD 7 268..307 8/46 (17%)
WD40 repeat 273..299 CDD:293791 7/33 (21%)
ARC40NP_009793.1 WD40 <5..315 CDD:225201 86/405 (21%)
WD40 repeat 22..61 CDD:293791 10/42 (24%)
WD40 repeat 67..104 CDD:293791 12/37 (32%)
WD40 repeat 110..149 CDD:293791 10/44 (23%)
WD40 repeat 157..203 CDD:293791 14/60 (23%)
WD40 repeat 217..254 CDD:293791 10/85 (12%)
WD40 repeat 258..295 CDD:293791 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.