DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POC1B and HIR1

DIOPT Version :9

Sequence 1:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens
Sequence 2:NP_009545.2 Gene:HIR1 / 852275 SGDID:S000000104 Length:840 Species:Saccharomyces cerevisiae


Alignment Length:484 Identity:100/484 - (20%)
Similarity:178/484 - (36%) Gaps:138/484 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    17 HKAAITSLDLSPNGKQLATASWDTFLMLW------NFKP-----HARAY-----RYVGHKDVVTS 65
            |..:||.:..||:||.||:.|.|..|::|      :.:|     |.|.:     |.|.|.:.:..
Yeast    78 HTGSITCVKFSPDGKYLASGSDDRILLIWALDEEQSSQPAFGSEHEREHWTVRKRLVAHDNDIQD 142

Human    66 VQFSPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWS 130
            :.::|..::|.:...||:|.:|......|...|..|.:.|:.|.|....::.||.|:|:::|::.
Yeast   143 ICWAPDSSILVTVGLDRSVIVWNGSTFEKLKRFDVHQSLVKGVVFDPANKYFATTSDDRTMKIFR 207

Human   131 MYRQRFLYSLYRH-----------THWVRCAKFSPDGRLI---------VSCSEDKTIKIWDTTN 175
            .::...:.....|           |.:.|...:||||:.|         ||.........|| ||
Yeast   208 YHKTGDISFTIEHIITEPFKESPLTTYFRRPSWSPDGQHIAVPNATNGPVSSVAIVNRGTWD-TN 271

Human   176 KQCVNN-------------FSDSVGFANFVDFNPSG------------------TCIASAGSDQT 209
            ...:.:             |..:.|.....|.:|..                  :.:|:||.|::
Yeast   272 VSLIGHDAPTEVARFNPRLFERNAGVKQKKDDDPENALVGQNDDKVHHFDKNIDSVVATAGQDKS 336

Human   210 VKVWDV-RVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKI------------------- 254
            :.||.. |...:|..:.:.:..:..:|::|.|:.|..||.|.::.:                   
Yeast   337 LAVWSTSRPRPILVAFDIANKSITDMSWNPDGSLLFVASLDSSITLFKFENNELGKPIPLEKNME 401

Human   255 -----------LDLLE--GRLIYTLQGHTGPVFTVSFSKGGE---LFASGGADTQ---------- 293
                       ||..|  .:|:...|..:.....:|.||.||   ..|:..|..|          
Yeast   402 QLYRYGVDKDSLDFPESINQLLLEDQTKSFKHTKISTSKLGENHPTLATNSASNQKDNNDASVSR 466

Human   294 -----VLLWRTNFDELHCKGLT-KRNLKRLHFDSPPHLLDIYPRTPHPHEEKVETVE-------- 344
                 :|:.:...|.:..|.:| |...||:    .|.|:.....:|..:..|..|::        
Yeast   467 SEHINILIPKRKKDAILNKAVTLKSGKKRV----APTLISTSSSSPFSNGIKKPTLDSKRIENNV 527

Human   345 ------INPKLEVIDLQISTPPVMDILSF 367
                  ||.|..::::.......:.|.||
Yeast   528 KSSTKTINSKNTLLNVPEGVEKKISISSF 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POC1BNP_758440.1 WD40 10..298 CDD:238121 83/398 (21%)
WD 1 16..55 16/53 (30%)
WD40 repeat 21..58 CDD:293791 16/52 (31%)
WD 2 58..99 8/40 (20%)
WD40 repeat 63..100 CDD:293791 8/36 (22%)
WD 3 101..139 9/37 (24%)
WD40 repeat 106..142 CDD:293791 7/35 (20%)
WD 4 142..181 14/58 (24%)
WD40 repeat 147..182 CDD:293791 12/56 (21%)
WD 5 183..223 11/58 (19%)
WD40 repeat 190..225 CDD:293791 10/53 (19%)
WD 6 226..265 11/70 (16%)
WD40 repeat 231..267 CDD:293791 11/67 (16%)
WD 7 268..307 10/56 (18%)
WD40 repeat 273..299 CDD:293791 9/43 (21%)
HIR1NP_009545.2 WD40 20..384 CDD:421866 69/306 (23%)
WD40 repeat 20..66 CDD:293791
WD40 repeat 83..135 CDD:293791 15/51 (29%)
WD40 repeat 140..176 CDD:293791 7/35 (20%)
WD40 repeat 183..228 CDD:293791 8/44 (18%)
WD40 repeat 235..275 CDD:293791 12/40 (30%)
WD40 repeat 283..350 CDD:293791 11/66 (17%)
WD40 repeat 359..383 CDD:293791 7/23 (30%)
Hira 735..>807 CDD:400109
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.