DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POC1B and CG10064

DIOPT Version :10

Sequence 1:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens
Sequence 2:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster


Alignment Length:405 Identity:83/405 - (20%)
Similarity:151/405 - (37%) Gaps:55/405 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    17 HKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRD 81
            |..::..:....|...:...|....:.:|:........|.:.:......|:|:..|..:.|...|
  Fly   366 HTKSVYCITFPKNYSGVFATSGKECIRIWSSGRKQELLRIMVYNFNCACVRFTHDGTSIVSVWND 430

Human    82 RTVRLWIP-DKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSM--YRQRFLYSLYRH 143
            ..:|.:.| ..|..::...||.....::..::.|:.:.|...:..::||.:  |||..:..|..|
  Fly   431 GIIRAFTPITGRLIYAIPNAHNKGCSALAVASSGRLIVTGGIEGQVRVWKIDPYRQDLVGVLKDH 495

Human   144 THWVRCAKFSPDGRLIVSCSEDKTIKIWD---TTNKQCVNNFSDSVGFANFVDFNPSGTCIASAG 205
            :..:.....:.....::|...|.:..|||   .|.||.|...:..:..:.|    |:|..:.:.|
  Fly   496 SGPITSLDINYLDTEVISACTDGSCVIWDIKRMTRKQVVTANTQFMSASYF----PTGVQVITCG 556

Human   206 SDQTVKVWDVRVNKLLQHYQV-HSGGVNCISFHPSGNYLITASSDGTLKILDLLEGRLIYTLQGH 269
            ||..:..|.|....|::.... ....|||::.:.:|:|.||..||..:|:.|...|.::.....|
  Fly   557 SDGRIIYWMVYNGALIRELTASKKSSVNCLAINETGDYFITVGSDLQVKLWDYNSGAVVGIGSEH 621

Human   270 TGPVFTVSFSKGGELFASGGADTQVLLWRTNFDELHCKGLTKRNLKRLHFDSPPHLLDIYPRTPH 334
            ...|.:.::|....:|.:|..|..:::|                      |.|   .|.:.|...
  Fly   622 ASSVISCAYSPCMTMFVTGSTDGSLIIW----------------------DVP---RDFWGRPNP 661

Human   335 PHEEKVETVEINPKLEVIDLQISTPPVMDILSFDSTTTTETSGRTLPDKGEEACGYFL---NPSL 396
            |...|....:.:.|..:.|:....         :|.|..:|:      |||...|...   ...|
  Fly   662 PDVTKYSLPKTSSKTRMSDVPSRV---------NSGTNLKTT------KGENIDGLLKATPKDDL 711

Human   397 MSPECLPTTTKKKTE 411
            ...|| |...||.|:
  Fly   712 CCVEC-PPCAKKDTK 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POC1BNP_758440.1 WD40 <5..300 CDD:441893 61/289 (21%)
WD 1 16..55 4/37 (11%)
WD40 repeat 21..58 CDD:293791 4/36 (11%)
WD 2 58..99 8/41 (20%)
WD40 repeat 63..100 CDD:293791 8/37 (22%)
WD 3 101..139 8/39 (21%)
WD40 repeat 106..142 CDD:293791 8/37 (22%)
WD 4 142..181 10/41 (24%)
WD40 repeat 147..182 CDD:293791 9/37 (24%)
WD 5 183..223 9/39 (23%)
WD40 repeat 190..225 CDD:293791 9/34 (26%)
WD 6 226..265 12/39 (31%)
WD40 repeat 231..267 CDD:293791 12/35 (34%)
WD 7 268..307 7/38 (18%)
WD40 repeat 273..299 CDD:293791 6/25 (24%)
CG10064NP_648065.1 WD40 <59..482 CDD:441893 19/115 (17%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 366..650 CDD:238121 61/309 (20%)
WD40 repeat 370..407 CDD:293791 4/36 (11%)
WD40 repeat 412..449 CDD:293791 8/36 (22%)
WD40 repeat 456..494 CDD:293791 8/37 (22%)
WD40 repeat 499..535 CDD:293791 8/35 (23%)
WD40 repeat 541..576 CDD:293791 9/38 (24%)
WD40 repeat 583..617 CDD:293791 12/33 (36%)
WD40 repeat 625..651 CDD:293791 6/47 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.