| Sequence 1: | NP_758440.1 | Gene: | POC1B / 282809 | HGNCID: | 30836 | Length: | 478 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_595682.1 | Gene: | pop3 / 2540645 | PomBaseID: | SPBC21B10.05c | Length: | 314 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 304 | Identity: | 73/304 - (24%) |
|---|---|---|---|
| Similarity: | 113/304 - (37%) | Gaps: | 78/304 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Human 65 SVQFSP-HGNLLASASRDRTVRLW-----------------------IPDKRGKF---------- 95
Human 96 ------------SEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVR 148
Human 149 CAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNF--SDSVGFANFVDFNPSGTCIASAGSDQTVK 211
Human 212 VWDVRVNKLLQH-----------YQVHSGGVNCISFHPSGNYLITASSDGTLKILD------LLE 259
Human 260 GRLIYTLQGHTGPVFTVSFSKGGELFASGGADTQVLLWRTNFDE 303 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| POC1B | NP_758440.1 | WD40 | 10..298 | CDD:238121 | 71/297 (24%) |
| WD 1 | 16..55 | ||||
| WD40 repeat | 21..58 | CDD:293791 | |||
| WD 2 | 58..99 | 17/79 (22%) | |||
| WD40 repeat | 63..100 | CDD:293791 | 18/80 (23%) | ||
| WD 3 | 101..139 | 17/37 (46%) | |||
| WD40 repeat | 106..142 | CDD:293791 | 14/35 (40%) | ||
| WD 4 | 142..181 | 8/38 (21%) | |||
| WD40 repeat | 147..182 | CDD:293791 | 7/34 (21%) | ||
| WD 5 | 183..223 | 5/39 (13%) | |||
| WD40 repeat | 190..225 | CDD:293791 | 5/45 (11%) | ||
| WD 6 | 226..265 | 11/44 (25%) | |||
| WD40 repeat | 231..267 | CDD:293791 | 10/41 (24%) | ||
| WD 7 | 268..307 | 9/36 (25%) | |||
| WD40 repeat | 273..299 | CDD:293791 | 6/25 (24%) | ||
| pop3 | NP_595682.1 | WD40 | 1..287 | CDD:238121 | 71/297 (24%) |
| WD40 | 9..>301 | CDD:225201 | 69/297 (23%) | ||
| WD40 repeat | 44..81 | CDD:293791 | 6/38 (16%) | ||
| WD40 repeat | 86..122 | CDD:293791 | 15/36 (42%) | ||
| WD40 repeat | 128..163 | CDD:293791 | 6/34 (18%) | ||
| WD40 repeat | 170..212 | CDD:293791 | 5/47 (11%) | ||
| WD40 repeat | 218..256 | CDD:293791 | 10/41 (24%) | ||
| WD40 repeat | 262..286 | CDD:293791 | 4/23 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||