DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POC1B and SPBC32H8.09

DIOPT Version :9

Sequence 1:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens
Sequence 2:NP_595615.1 Gene:SPBC32H8.09 / 2540228 PomBaseID:SPBC32H8.09 Length:483 Species:Schizosaccharomyces pombe


Alignment Length:406 Identity:75/406 - (18%)
Similarity:150/406 - (36%) Gaps:85/406 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    21 ITSLDLSPNGKQLATASWDTFLMLWNFK-------PHAR---AYRYVGHKDVVTSVQFSPHGNLL 75
            ::|:..||:|:.|..:|:|:.:.:|:..       ||.:   :..|..|    .|:||.   .:|
pombe   103 LSSISWSPSGELLLWSSFDSKITVWSLNTQKGYLLPHVKTNVSKVYALH----PSMQFC---TIL 160

Human    76 ASASRDRTVRLWIPDKRG--KFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLY 138
            :..:....::.:...|:.  ...|.|..|.....:.:|.||.:||.........|:..:|...|:
pombe   161 SRFNGSDCLQFYQISKKAWILLKECKLPTIDSTGIHWSPDGNWLAVLENVLDAVVYIYHRTGLLF 225

Human   139 SLYRHTHWVRCA----KFSPDGRLIVSCS-EDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSG 198
            ..||....:...    ::||.|:.:..|| .|.|:.:.:|.....|.....              
pombe   226 HEYRPNRLIEVGFSDFEWSPFGKYLTLCSYHDSTLHLLETKTFSIVFRLHH-------------- 276

Human   199 TCIASAGSDQTVKVWDVR---VNKLLQHYQVHS----------GGVNCISFHPSGNY--LITASS 248
             |:....:|..:.:|:.:   ..:.:.:.:||.          ...:.|.|:....|  .||:..
pombe   277 -CLQYTNTDLEMHIWEEKETIYEQQMTYQKVHKLRTDFPEPSFCSASKIRFNCDETYAATITSKY 340

Human   249 DGTLKILDLLEGRL---------IYTLQGHTG----PVFTVSFSKGGELFASGGADTQVLLWRTN 300
            ...|.:.:|...:|         |...:.|.|    .|......|..::.::.   |.:..|..:
pombe   341 PNVLWLWNLQNKKLHTVLIQKHHIVYFEWHPGRPDLVVIQTKIRKESKIPSNA---TFLYFWALS 402

Human   301 FDELHCKGLTKR--NLKRL------HFDSPPHLL----DIYPRTPHPHEEKVETVEINPKL---E 350
            ::.....|:.|:  |::::      .|.|.|.::    |.|.......:|.....|:...:   |
pombe   403 WNTPRVVGVPKKGFNIQKVQWLQPSEFSSRPVIVICGEDAYTVAYIVEDEDESFTEVTQTIISQE 467

Human   351 VIDLQISTPPVMDILS 366
            |:|.::.|...:.|.|
pombe   468 VLDNELETTQTISIPS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POC1BNP_758440.1 WD40 10..298 CDD:238121 58/321 (18%)
WD 1 16..55 10/43 (23%)
WD40 repeat 21..58 CDD:293791 11/46 (24%)
WD 2 58..99 7/42 (17%)
WD40 repeat 63..100 CDD:293791 6/38 (16%)
WD 3 101..139 9/37 (24%)
WD40 repeat 106..142 CDD:293791 8/35 (23%)
WD 4 142..181 10/43 (23%)
WD40 repeat 147..182 CDD:293791 9/39 (23%)
WD 5 183..223 3/42 (7%)
WD40 repeat 190..225 CDD:293791 3/37 (8%)
WD 6 226..265 11/59 (19%)
WD40 repeat 231..267 CDD:293791 9/46 (20%)
WD 7 268..307 6/42 (14%)
WD40 repeat 273..299 CDD:293791 4/25 (16%)
SPBC32H8.09NP_595615.1 WD40 13..274 CDD:295369 39/177 (22%)
WD40 100..416 CDD:225201 61/337 (18%)
WD40 repeat 104..152 CDD:293791 12/51 (24%)
WD40 repeat 157..191 CDD:293791 5/36 (14%)
WD40 repeat 193..228 CDD:293791 8/34 (24%)
WD40 repeat 238..273 CDD:293791 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.