DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POC1B and Y41C4A.32

DIOPT Version :9

Sequence 1:NP_758440.1 Gene:POC1B / 282809 HGNCID:30836 Length:478 Species:Homo sapiens
Sequence 2:NP_499518.2 Gene:Y41C4A.32 / 189814 WormBaseID:WBGene00270321 Length:291 Species:Caenorhabditis elegans


Alignment Length:299 Identity:70/299 - (23%)
Similarity:127/299 - (42%) Gaps:33/299 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    14 FKGHKAAITSLDLSPNGKQLATASWDTFLMLWNF------------KPHARAYRYVGHKDVVTSV 66
            |..|...:.|:|.......:.||.....:.:||:            :...||.:::..|      
 Worm     8 FVSHSDRVKSVDFHSEKPWILTALHTGNVQIWNYDTKTLVKAMEVSEKSTRAAKFIHRK------ 66

Human    67 QFSPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSM 131
                  |.:|:||.|:.:|::..:.....:||.||:..:||:.......:|.:||:|:.|:||..
 Worm    67 ------NWIATASDDQQIRIFDAETFSLINEFTAHSDFIRSLTVHPTLPYLISASDDRKIRVWDW 125

Human   132 YRQ-RFLYSLYRHTHWVRCAKFSP-DGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDF 194
            ..: |.......|.|::.....:| |..:.||.|.|||:|:|....::.:..........|.|:|
 Worm   126 ENEWRMEQEFQEHAHYIMQIAVNPEDPEMFVSGSLDKTLKVWKLGEQESICTLEGHEKGVNCVEF 190

Human   195 NPSGTCIASAGSDQTVKVWDVRVNKLLQHYQ-VHSGGVNCISFHPSGNYLITASSDGTLKILDLL 258
            ...|. |.|...|.::.|||::..|.::..: .|...|..::  |...::|:.:.|.|:||.:..
 Worm   191 LTGGR-IVSGSDDCSICVWDIQTQKCIETLKNAHKNNVTFVT--PFKTWIISGAEDSTVKIWNSQ 252

Human   259 EGRLIYTLQGHTGPVFTVSFSKGGEL---FASGGADTQV 294
            ...|...|....|..:.|:..|...:   |.||....::
 Worm   253 TFSLEKELNFEKGRAWCVAAGKSDAIAVGFDSGAVTVEI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POC1BNP_758440.1 WD40 10..298 CDD:238121 70/299 (23%)
WD 1 16..55 9/50 (18%)
WD40 repeat 21..58 CDD:293791 8/48 (17%)
WD 2 58..99 8/40 (20%)
WD40 repeat 63..100 CDD:293791 8/36 (22%)
WD 3 101..139 11/38 (29%)
WD40 repeat 106..142 CDD:293791 10/36 (28%)
WD 4 142..181 12/39 (31%)
WD40 repeat 147..182 CDD:293791 10/35 (29%)
WD 5 183..223 11/39 (28%)
WD40 repeat 190..225 CDD:293791 11/34 (32%)
WD 6 226..265 9/38 (24%)
WD40 repeat 231..267 CDD:293791 8/35 (23%)
WD 7 268..307 6/30 (20%)
WD40 repeat 273..299 CDD:293791 5/25 (20%)
Y41C4A.32NP_499518.2 WD40 8..271 CDD:238121 65/277 (23%)
WD40 repeat 17..52 CDD:293791 6/34 (18%)
WD40 repeat 58..94 CDD:293791 11/47 (23%)
WD40 repeat 99..136 CDD:293791 10/36 (28%)
WD40 repeat 143..179 CDD:293791 10/35 (29%)
WD40 repeat 185..220 CDD:293791 11/35 (31%)
WD40 repeat 224..251 CDD:293791 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.