DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR4 and TkR86C

DIOPT Version :9

Sequence 1:NP_005273.1 Gene:GPR4 / 2828 HGNCID:4497 Length:362 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:398 Identity:92/398 - (23%)
Similarity:158/398 - (39%) Gaps:96/398 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    12 DSRVDHLFP------------PSLYIFVIG----VGLPTNCLALWAAYRQVQQRNELGVYLMNLS 60
            |...:.|||            .:::..:.|    |.:..|.:.||........|.....:|:|||
  Fly    62 DFLTECLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLS 126

Human    61 IADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRF 125
            |||||......::...|:.:.:|..|...|.:..|:....:..|:..|..||.|||:|:.|||:.
  Fly   127 IADLLMSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLKR 191

Human   126 ARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRY----NHTFCFEKFPMEGWVAWM----- 181
            ...||....:.|  ::||.....::..|.:..:....|    :.|.||..:|...:...|     
  Fly   192 RTSRRKVRIILV--LIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADYAY 254

Human   182 NLYRVFVGFLFPWALMLLSYRGILRAVRGSVS----TERQ-----EKAKIKRLALSLIAIVLVCF 237
            ||..:.:.:..|..:||:.|..:.|.:.||.|    |:||     .|.|:.|:.:::::|..:|:
  Fly   255 NLIILVLTYGIPMIVMLICYSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICW 319

Human   238 APYHVLLLSR------------SAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVN 290
            .|||:..:..            ..:|||..|               ||.:  |.:.:|::|..:|
  Fly   320 LPYHLFFIYAYHNNQVASTKYVQHMYLGFYW---------------LAMS--NAMVNPLIYYWMN 367

Human   291 EGARSDVAKAL---------HNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAA-- 344
            :..|....:.:         |   ||   |.|          ::.||:|.:|......|...|  
  Fly   368 KRFRMYFQRIICCCCVGLTRH---RF---DSP----------KSRLTNKNSSNRHTRGGYTVAHS 416

Human   345 ----TPPS 348
                :||:
  Fly   417 LPNSSPPT 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR4NP_005273.1 7tmA_GPR4 18..297 CDD:320488 78/324 (24%)
TM helix 1 20..44 CDD:320488 6/39 (15%)
TM helix 2 53..74 CDD:320488 9/20 (45%)
TM helix 3 91..113 CDD:320488 4/21 (19%)
TM helix 4 136..152 CDD:320488 3/15 (20%)
TM helix 5 179..202 CDD:320488 6/27 (22%)
TM helix 6 223..245 CDD:320488 6/21 (29%)
TM helix 7 265..290 CDD:320488 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..362 4/20 (20%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 74/302 (25%)
7tm_1 100..363 CDD:278431 70/281 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.