DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment timm9 and Tim9b

DIOPT Version :9

Sequence 1:NP_001153383.1 Gene:timm9 / 282678 ZFINID:ZDB-GENE-021206-14 Length:89 Species:Danio rerio
Sequence 2:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:30/53 - (56%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish    11 IKQFKEFLGTYNKLTENCFMDCVKDFTTREVKPEETTCSESCLQKYLKMTQRI 63
            ::..|:|...|||:||.||..||.:.:.|::...|..|.:.|:.|:.:..|.:
  Fly     5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNM 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
timm9NP_001153383.1 zf-Tim10_DDP 10..67 CDD:281019 17/53 (32%)
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.