DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment f7i and flz

DIOPT Version :9

Sequence 1:NP_775335.1 Gene:f7i / 282671 ZFINID:ZDB-GENE-021206-10 Length:443 Species:Danio rerio
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:119/273 - (43%) Gaps:41/273 - (15%)


- Green bases have known domain annotations that are detailed below.


Zfish   172 CGKIPVQKNTSQNQFLGGIHCPRGHCPWQVLIDYN------GESVCGGALLEGPWLITAAHCVHQ 230
            ||   |:.:....:.:||.....|..|||||:..:      .::.|||.|:...::||||||   
  Fly  1438 CG---VRPHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHC--- 1496

Zfish   231 KDTRFLK---AVTGEHDL--DVLDGSEEPYEVSAVFIHPNYDPETLDSDLALLRLRVPVQRSLYA 290
             ...||.   ||.||.|:  |:.........|..|.:|..|||.|.::|||||.|..|||...:.
  Fly  1497 -QPGFLASLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHI 1560

Zfish   291 VPICLPTPQLARSELWAARFHTLSGWGTRTAGHNLRREKGLKGPASGTLQRLAVPLLPAAQC--- 352
            ||||:|.....    :..|..|::|||....|          |.....||.:.||::..:.|   
  Fly  1561 VPICMPNDVAD----FTGRMATVTGWGRLKYG----------GGVPSVLQEVQVPIIENSVCQEM 1611

Zfish   353 -----GNANTTANMFCAGYTEGDHASCRGHDGSPLVTRYGETSF-LTGVVSWGRGCGPPGYYWIY 411
                 .|.....:..||||..|...||.|..|.|||.:..:..: |.|.||.|..|..|....:|
  Fly  1612 FHTAGHNKKILTSFLCAGYANGQKDSCEGDSGGPLVLQRPDGRYELAGTVSHGIKCAAPYLPGVY 1676

Zfish   412 TKVENFLIWMDTV 424
            .:...:..|:.::
  Fly  1677 MRTTFYKPWLRSI 1689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
f7iNP_775335.1 GLA 20..82 CDD:214503
EGF_CA <91..120 CDD:238011
FXa_inhibition 129..164 CDD:291342
Tryp_SPc 188..420 CDD:214473 80/251 (32%)
Tryp_SPc 188..420 CDD:238113 80/251 (32%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 81/257 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.