DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sebox and Drgx

DIOPT Version :9

Sequence 1:NP_001306981.1 Gene:sebox / 282666 ZFINID:ZDB-GENE-021206-4 Length:293 Species:Danio rerio
Sequence 2:NP_001097075.2 Gene:Drgx / 5740176 FlyBaseID:FBgn0085369 Length:587 Species:Drosophila melanogaster


Alignment Length:237 Identity:62/237 - (26%)
Similarity:95/237 - (40%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


Zfish    46 PELDRTGHVEGQRKRKRTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESKIQVWFQNRR 110
            |.:.....|..:::|.||.|:..||.|||.||..|.|||:..||.||....|.|:::||||||||
  Fly    40 PAIHDETFVRRKQRRNRTTFTLQQLEELETAFAQTHYPDVFTREDLAMKINLTEARVQVWFQNRR 104

Zfish   111 ARSMKSKKLITPVSRRSPAKDCTFPATHPDLNLEQSPEANKSLRHHQQSLIRQALNPWPQNRPPI 175
            |:..|:::|          ||        :....::.|::.||         ..|:...::.|.|
  Fly   105 AKWRKAERL----------KD--------EQRKRENGESSSSL---------DKLHDSRESSPDI 142

Zfish   176 SPDLPEILQWANRNSETPGDSSFSSCPSERIQHPFPN----QSSSVWQMNCFAAHPEGLKSYCTT 236
            :.::.:.:      .:.|        |.:|...|..|    |..|....:..:..|.|       
  Fly   143 TGEIDDDM------DDLP--------PRQRSHSPLANGQMEQQHSHSHSHSHSRSPGG------- 186

Zfish   237 SQALYSSVSVDQMIPAHPSSLEEALQRQALTHYPQTSLGDIS 278
                  .:.:|......|.|   :.|..|..|....|||.||
  Fly   187 ------GMHLDSSDNERPLS---SNQLTATPHSASQSLGSIS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seboxNP_001306981.1 COG5576 13..159 CDD:227863 39/112 (35%)
Homeobox 61..112 CDD:278475 28/50 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..144 3/26 (12%)
DrgxNP_001097075.2 Homeobox 56..108 CDD:278475 29/51 (57%)
OAR 428..445 CDD:281777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.