DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhrs4 and CG31546

DIOPT Version :9

Sequence 1:NP_001033027.2 Gene:Dhrs4 / 28200 MGIID:90169 Length:279 Species:Mus musculus
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:248 Identity:76/248 - (30%)
Similarity:133/248 - (53%) Gaps:7/248 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse    32 SNKVALVTASTDGIGFAIARRLAEDGAHVVVSSRKQQNVDRAVATLQGEGLSVTGIVCHVGKAED 96
            |.||.|:|.:..|||.|.|...::.||.:.:..|:::.:...:......|....||...:.|..:
  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPE 76

Mouse    97 REKLITTALKRHQG-IDILVSNAAVNPFFGNLMDVTEEVWDKVLSINVTATAMMIKAVVPEMEKR 160
            .|.:.....:|::| :|:||:.|.:.| .|.|.......:..|:..||.:...:.|.::|:: .:
  Fly    77 IECIARKTTERYEGKLDVLVNGAGIMP-TGTLQSTELACFTHVMEANVRSGFYLTKLLLPQL-LQ 139

Mouse   161 GGGSVVIVGSVAGFTRFPSLGPYNVSKTALLGLTKNFAAELAPKNIRVNCLAPGLIKTRFSSV-L 224
            ..||:|.|.||.|...||:|..||:||.|:...|::.|.:|.|:.:|||.:.||:|:|..... .
  Fly   140 CKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAGG 204

Mouse   225 WEEKAREDFI---KEAMQIRRLGKPEDCAGIVSFLCSEDASYINGETVVVGGG 274
            .:|::..:|:   |:...:.|:|:|::.|..:.||.||.||::.|.|:.|.||
  Fly   205 MDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhrs4NP_001033027.2 CR_SDR_c 24..279 CDD:187641 76/248 (31%)
fabG 31..274 CDD:235975 74/246 (30%)
Microbody targeting signal 277..279
CG31546NP_730973.1 fabG 9..257 CDD:235975 74/246 (30%)
NADB_Rossmann 11..261 CDD:304358 76/248 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830572
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.