DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPC1 and dally

DIOPT Version :9

Sequence 1:NP_002072.2 Gene:GPC1 / 2817 HGNCID:4449 Length:558 Species:Homo sapiens
Sequence 2:NP_001246685.1 Gene:dally / 39013 FlyBaseID:FBgn0263930 Length:626 Species:Drosophila melanogaster


Alignment Length:535 Identity:127/535 - (23%)
Similarity:217/535 - (40%) Gaps:92/535 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    24 DPASKSRSCGEVRQIYGAKG-FSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELET 87
            |..:|....|...|....|. |...|:..:....|...||  |..||.:..|..|.:::....|.
  Fly    55 DSRAKDAVGGSTHQCDAVKSYFESIDIKSSGTYSEKGAIC--GGNCCNNATELELRDKAAGMFEQ 117

Human    88 ALRDSSRVLQAMLATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSEL--RL 150
            .|...:..|:.:|.|..:.|..|...|...||....:.|...:..:...:......||:|:  .|
  Fly   118 LLHHHTSSLRGVLETNAKQFQSHVLELAQISENMTHSLFSKVYTRMVPSSRMMIHQLYTEIMNHL 182

Human   151 YY-------------RG---ANLHLEETLAEFWARLLERLFKQLHPQLL---------LPDDYLD 190
            .|             ||   ...:|||.:..|:.    :||...:.|::         |.:||::
  Fly   183 IYTSNYTNSNGQLGRRGIGSVQSNLEEAVRHFFV----QLFPVAYHQMVHLSKNNLGDLHEDYVN 243

Human   191 CLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV---PLGPECSRAVMK 252
            ||....:.:.|||:.|::::....::...:..|:..|..|::|:.:...:   .|...|...::|
  Fly   244 CLQHNFDEMHPFGDIPQQVQSNLGKSVHMSNVFMNALLQAAEVLSEADALYGEQLTDTCKLHLLK 308

Human   253 LVYCAHCLGVPGA-----RPCPDYCRNVLKGCLANQAD-LDAEWRNLLDSM-VLITDKFWGTSGV 310
            :.||.:|.|...:     :.|..||:||::||.|..|. ||:.|..::||: .|:|......:|:
  Fly   309 MHYCPNCNGHHSSSRSETKLCYGYCKNVMRGCSAEYAGLLDSPWSGVVDSLNNLVTTHILSDTGI 373

Human   311 ESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRRRGKLAPRERPPS--- 372
            .:||..:.|:.:|||.|...|...|..||.:.||.|.:.|...|          .|..|||.   
  Fly   374 INVIKHLQTYFSEAIMAAMHNGPELEKKVKKTCGTPSLTPYSSG----------EPDARPPPHKN 428

Human   373 ----------------GTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMAR 421
                            .|::|           .::|:.::....|.|:.  .:..|..||:|...
  Fly   429 NVKWATDPDPGMVLFLSTIDK-----------SKEFYTTIVDNFCDEQQ--HSRDDHSCWSGDRF 480

Human   422 GRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDV----DFQDAS 482
            |.|...::..|..:|..||||..:.......:.:.:.:|..:...:.:|...|.:    |.|  :
  Fly   481 GDYTQLLINPGTDSQRYNPEVPFNAKAQTGKLNELVDKLFKIRKSIGAAAPSNSIQATHDIQ--N 543

Human   483 DDGSGSGSGDGCLDD 497
            |.|.|||.|:|.:.|
  Fly   544 DMGEGSGGGEGQIGD 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPC1NP_002072.2 Glypican 22..533 CDD:366494 127/535 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..374 9/51 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 505..534
dallyNP_001246685.1 Glypican 51..622 CDD:279494 127/535 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3821
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.