DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GP2 and Ndg

DIOPT Version :9

Sequence 1:NP_001007241.2 Gene:GP2 / 2813 HGNCID:4441 Length:537 Species:Homo sapiens
Sequence 2:NP_610575.1 Gene:Ndg / 36089 FlyBaseID:FBgn0026403 Length:1350 Species:Drosophila melanogaster


Alignment Length:547 Identity:97/547 - (17%)
Similarity:177/547 - (32%) Gaps:193/547 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    32 GYG-NPIEASSYGL--DL-DCGAPGTPEAHVCFDPCQ---NYT------LLDEPFRSTENSAGSQ 83
            ||. :||...|..:  |: |..|....|.|:....||   .||      .|....:|.|:...:.
  Fly   825 GYNCDPISDDSCAIRPDICDVHADCVYEEHLGKSECQCQAGYTGNGFNCQLAAECQSAEHCGENA 889

Human    84 GCDKNMSGWYRFVGEGGVRMSETCVQVHRC--------------QTDAPMWLNGTHPALGDGITN 134
            .||   .|..|...:....:|:.||...||              ..:...:.:......||.:|.
  Fly   890 FCD---DGVCRCQADFERDVSDRCVPAGRCGSVFCGSNAICKWDSAEGVQYCDCLDGYQGDALTG 951

Human   135 HTA---CAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCTVPRDPSTVEDKC------ 190
            .|:   ..|...||              |.|.            .|....||:..|.:|      
  Fly   952 CTSKPLSCHVLNNC--------------GIHA------------TCEPTEDPANYECQCIAGFKG 990

Human   191 -EKACRPEEECL-------------ALNSTWGCFCRQDL--NSSDVHSLQPQ------LDCGPRE 233
             ...|..|:.||             :.||...|.|.|..  |.|.....|.|      :..|   
  Fly   991 DGYVCIEEQNCLNNPTLCDMNAQCRSTNSGLVCVCNQGFFGNGSLCQERQHQDSDFLIVSQG--- 1052

Human   234 IKVKVDKCLLGG------------LGLGEEVI---AYLRDPNCSSILQ-----TEERNWVSVTSP 278
              |.:.:..|.|            :||.::.:   .|..|.:...|:.     |:.|.:::....
  Fly  1053 --VMIARVPLNGRNVRPISVAQMAIGLDKDCVEGRVYWGDISTKKIVSTKYDGTDLRPFITTDIE 1115

Human   279 VQASACRNILERNQTHAIY-----KNTLSL--VNDFIIRDTILNINFQCAYPLDMKVSLQAALQP 336
            .......:::.|.    :|     |:|:.:  ::|..:|..|:|                   :.
  Fly  1116 SPEGIAIDVISRR----LYWADSAKDTIEVASLDDPSLRAVIIN-------------------KQ 1157

Human   337 IVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVESVLYVG--AILEQGDTSRFN--LV 397
            :|:...::||.          ::::.:.:.::.::.::.:.::...|  .:|.:.|.:..|  :|
  Fly  1158 LVNPRGIAVDP----------YREKLFWSDWDRESPKIEMSNLDGTGRELLLGKDDVTLPNSLVV 1212

Human   398 LRN----CYATPTEDKADLVKYFIIRNSCSNQRDSTIHVEENGQSSESRFSVQMFMFAGHYDLVF 458
            |.|    |||.....|.:.::       ..|::..||       |:|..:.         :.:.|
  Fly  1213 LENSGEVCYADAGTKKVECIE-------PQNRQIRTI-------SNELSYP---------FGITF 1254

Human   459 LHCE----------IHLCDSLNEQCQP 475
            .|.:          :.:.|||..:..|
  Fly  1255 THDQFYWTDWTTKKVEIVDSLGARQTP 1281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GP2NP_001007241.2 ZP 229..480 CDD:214579 44/292 (15%)
Zona_pellucida 358..478 CDD:278526 22/136 (16%)
NdgNP_610575.1 NIDO 108..262 CDD:214712
EGF_3 285..320 CDD:372403
G2F 322..549 CDD:214774
EGF_CA 591..627 CDD:311536
EGF_3 797..828 CDD:372403 2/2 (100%)
EGF_3 836..873 CDD:372403 9/36 (25%)
EGF_3 963..995 CDD:372403 9/57 (16%)
EGF_3 1001..1036 CDD:372403 9/34 (26%)
NHL 1059..>1275 CDD:302697 39/271 (14%)
NHL repeat 1067..1103 CDD:271320 5/35 (14%)
Ldl_recept_b 1084..1123 CDD:393440 5/38 (13%)
LY 1107..1145 CDD:214531 5/41 (12%)
NHL repeat 1117..1154 CDD:271320 6/40 (15%)
LY 1152..1195 CDD:214531 5/71 (7%)
NHL repeat 1161..1198 CDD:271320 3/46 (7%)
NHL repeat 1204..1245 CDD:271320 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.