DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GP2 and mua-3

DIOPT Version :9

Sequence 1:NP_001007241.2 Gene:GP2 / 2813 HGNCID:4441 Length:537 Species:Homo sapiens
Sequence 2:NP_001022674.1 Gene:mua-3 / 176430 WormBaseID:WBGene00003482 Length:3767 Species:Caenorhabditis elegans


Alignment Length:267 Identity:58/267 - (21%)
Similarity:91/267 - (34%) Gaps:100/267 - (37%)


- Green bases have known domain annotations that are detailed below.


Human    56 AHVCFDPCQNYTL--------LDE---PFRSTEN-------SAGSQGCDKNMSGWYRFVGEGGVR 102
            || |.|..:.|:.        :||   |.|..|.       |.|...||:|              
 Worm  1724 AH-CIDTIEGYSCICKPGFVDMDEFGNPGRRCEQIKTNDKCSPGKNDCDRN-------------- 1773

Human   103 MSETCVQVHRCQTDAPMWLNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLE 167
              ..|:|:                  ||   :..:|                 |||.|:.    :
 Worm  1774 --ARCIQI------------------GD---DDYSC-----------------ACPPGFK----D 1794

Human   168 GTPWCNL--RYC--TVPR-DPSTVEDKCEKACRPEEECLALNSTWGCFCRQD-LNSSDVHSLQPQ 226
            .:|..:.  |.|  .:|. |..|:.| |:...|  ..|...:..:.|.|||. |:.|...|::|.
 Worm  1795 KSPSSSRPGRLCIPVIPECDNPTLND-CDSPDR--AVCTDTDDGYMCRCRQGFLDISPSISVKPG 1856

Human   227 LDCGP--REIKVKVDKCLLGGLGLGEEVIAYLRDPN---CSSILQTEERNWVSVTSPVQASACRN 286
            ..|.|  .|..:.:|.|...| |:.|:      :|:   |...:...:.::..||.|  ...|:.
 Worm  1857 RLCKPLQNECALGIDDCARDG-GICED------NPDSFTCRCAMNYLDVSFDRVTRP--GRKCKR 1912

Human   287 ILERNQT 293
            ::...||
 Worm  1913 LINECQT 1919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GP2NP_001007241.2 ZP 229..480 CDD:214579 16/70 (23%)
Zona_pellucida 358..478 CDD:278526
mua-3NP_001022674.1 LDLa 32..60 CDD:238060
LDLa 131..164 CDD:238060
EGF_3 766..795 CDD:289699
vWA_collagen_alphaI-XII-like 1229..1398 CDD:238759
EGF_3 1662..1691 CDD:289699
EGF_CA 1709..1755 CDD:214542 9/31 (29%)
EGF_CA 1964..1997 CDD:214542
SEA 2873..2998 CDD:214554
SEA 3049..3173 CDD:214554
EGF_CA 3328..3364 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.